StarFunc result for job id P58546

User Input

>input (118 residues)
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGAD
INAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G9BZS8	0.992	0.992	3.555E-17	118	0.975	0.975	G9BZS8.pdb.gz	G9BZS8_PIG Myotrophin OS=Sus scrofa OX=9823 GN=MTPN PE=2 SV=1
2	PDB:7df7B	0.963	0.955	1.345E-15	119	0.983	0.975	7df7B.pdb.gz
3	AFDB:Q55FM5	0.938	0.923	4.642E-11	120	0.492	0.483	Q55FM5.pdb.gz	MTPN_DICDI Myotrophin homolog OS=Dictyostelium discoideum OX=44689 GN=mtpn PE=3 SV=1
4	AFDB:Q9BR61	0.904	0.389	5.870E-8	282	0.322	0.135	Q9BR61.pdb.gz	ACBD6_HUMAN Acyl-CoA-binding domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ACBD6 PE=1 SV=1
5	AFDB:C9JIJ7	0.896	0.415	9.260E-8	263	0.297	0.133	C9JIJ7.pdb.gz	C9JIJ7_HUMAN Ankyrin repeat domain 7 OS=Homo sapiens OX=9606 GN=ANKRD7 PE=1 SV=2
6	AFDB:Q8CGN4	0.883	0.063	9.741E-8	1759	0.322	0.022	Q8CGN4.pdb.gz	BCOR_MOUSE BCL-6 corepressor OS=Mus musculus OX=10090 GN=Bcor PE=1 SV=2
7	AFDB:Q6UB99	0.905	0.042	1.193E-7	2663	0.288	0.013	Q6UB99.pdb.gz	ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3
8	AFDB:E9Q4F7	0.905	0.042	1.389E-7	2643	0.297	0.013	E9Q4F7.pdb.gz	ANR11_MOUSE Ankyrin repeat domain-containing protein 11 OS=Mus musculus OX=10090 GN=Ankrd11 PE=1 SV=1
9	AFDB:Q6UB98	0.905	0.054	1.617E-7	2062	0.280	0.016	Q6UB98.pdb.gz	ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ANKRD12 PE=1 SV=3
10	AFDB:A2ABF8	0.926	0.094	1.789E-7	1233	0.331	0.032	A2ABF8.pdb.gz	A2ABF8_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
11	AFDB:F4JN13	0.846	0.296	1.789E-7	350	0.297	0.100	F4JN13.pdb.gz	F4JN13_ARATH Ankyrin repeat-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=AKR2 PE=1 SV=1
12	PDB:3ehqA	0.903	0.596	1.856E-7	182	0.271	0.176	3ehqA.pdb.gz
13	PDB:6jd6B	0.632	0.411	1.724E-6	192	0.331	0.203	6jd6B.pdb.gz
14	PDB:8cs9A	0.888	0.138	4.292E-6	796	0.305	0.045	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
15	PDB:6mwqA	0.560	0.176	4.996E-6	493	0.398	0.095	6mwqA.pdb.gz
16	PDB:2dvwA	0.881	0.469	8.722E-6	229	0.322	0.166	2dvwA.pdb.gz
17	PDB:5vkqA	0.845	0.073	1.015E-5	1499	0.314	0.025	5vkqA.pdb.gz
18	PDB:4oauC	0.858	0.156	1.124E-5	692	0.322	0.055	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
19	PDB:1bd8A	0.785	0.604	1.962E-5	156	0.331	0.250	1bd8A.pdb.gz
20	PDB:6v9hC	0.799	0.361	1.962E-5	270	0.263	0.115	6v9hC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P58546	8.10e-84	241	118	1.000	1.000	MTPN_HUMAN Myotrophin OS=Homo sapiens OX=9606 GN=MTPN PE=1 SV=2
2	Q3T0F7	8.10e-84	241	118	1.000	1.000	MTPN_BOVIN Myotrophin OS=Bos taurus OX=9913 GN=MTPN PE=1 SV=3
3	P62775	7.36e-83	239	118	0.992	0.992	MTPN_RAT Myotrophin OS=Rattus norvegicus OX=10116 GN=Mtpn PE=1 SV=2
4	G9BZS8	3.73e-82	237	118	0.975	0.975	G9BZS8_PIG Myotrophin OS=Sus scrofa OX=9823 GN=MTPN PE=2 SV=1
5	Q55FM5	9.38e-34	115	120	0.483	0.475	MTPN_DICDI Myotrophin homolog OS=Dictyostelium discoideum OX=44689 GN=mtpn PE=3 SV=1
6	P97582	3.71e-15	72.0	843	0.356	0.050	P97582_RAT Ankyrin (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
7	A0A5F9ZH38	4.17e-15	72.0	1739	0.339	0.023	A0A5F9ZH38_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
8	F1M5N3	5.02e-15	72.0	3966	0.339	0.010	F1M5N3_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=4
9	A0A0G2KBB9	5.38e-15	71.6	4017	0.339	0.010	A0A0G2KBB9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
10	F1LM42	6.04e-15	71.6	4021	0.339	0.010	F1LM42_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=4
11	A0A0G2JZ56	6.34e-15	71.6	4013	0.339	0.010	A0A0G2JZ56_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
12	A0A0G2K6R9	6.34e-15	71.6	3998	0.339	0.010	A0A0G2K6R9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
13	A0A0G2KAS9	6.34e-15	71.6	3980	0.339	0.010	A0A0G2KAS9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
14	Q8C8R3	6.34e-15	71.6	3898	0.339	0.010	ANK2_MOUSE Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2
15	F1M9N9	6.40e-15	71.6	3977	0.339	0.010	F1M9N9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=4
16	A0A5F9ZH03	6.72e-15	71.6	1785	0.339	0.022	A0A5F9ZH03_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	A0A5F9ZHD2	6.72e-15	71.6	3936	0.339	0.010	A0A5F9ZHD2_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	A0A5F9ZHF7	6.72e-15	71.6	3862	0.339	0.010	A0A5F9ZHF7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	A0A5F9ZHT4	6.72e-15	71.6	3870	0.339	0.010	A0A5F9ZHT4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZHT8	6.72e-15	71.6	3891	0.339	0.010	A0A5F9ZHT8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	3.6e-10	51.0	Ankyrin repeat
2	PF12796 Ank_2	1e-12	59.8	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.4e-10	51.3	Ankyrin repeat
4	PF13637 Ank_4	4.2e-16	70.3	Ankyrin repeats (many copies)
5	PF13857 Ank_5	5.8e-12	56.9	Ankyrin repeats (many copies)
6	PF04919 DUF655	4.2e+02	12.3	Protein of unknown function (DUF655)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 118797.XP_007466651.1

Rank	PPI partner	STRING score	Description
1	118797.XP_007459306.1	0.993	F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments
2	118797.XP_007450842.1	0.905	F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments
3	118797.XP_007459103.1	0.891	F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments
4	118797.XP_007453464.1	0.862	Beta-adducin
5	118797.XP_007468329.1	0.849	DNA methyltransferase 1 associated protein 1
6	118797.XP_007460977.1	0.822	Paired box 6
7	118797.XP_007470056.1	0.817	Belongs to the EF-1-beta/EF-1-delta family.
8	118797.XP_007463162.1	0.812	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. GPRK subfamily
9	118797.XP_007447609.1	0.810	Bifunctional enzyme that catalyzes the enolization of 2,3- diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK- MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).
10	118797.XP_007448940.1	0.810	Cytohesin-3
11	118797.XP_007452238.1	0.810	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 13 Proteins
12	118797.XP_007450454.1	0.790	Adducin-related protein 2-like
13	118797.XP_007471687.1	0.790	Adducin 1
14	118797.XP_007451504.1	0.763	Abhydrolase domain containing 12
15	118797.XP_007472336.1	0.763	Abhydrolase domain containing 12B
16	118797.XP_007458976.1	0.756	Transcription factor 12 isoform X1
17	118797.XP_007456140.1	0.749	E3 ubiquitin-protein ligase LNX isoform X1
18	118797.XP_007460187.1	0.738	Leucine-rich repeat-containing protein 57 isoform X1
19	118797.XP_007464629.1	0.717	Belongs to the EF-1-beta/EF-1-delta family.
20	118797.XP_007467973.1	0.717	Insulin receptor substrate 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0048518	0.987	positive regulation of biological process
GO:0051239	0.977	regulation of multicellular organismal process
GO:0051128	0.975	regulation of cellular component organization
GO:0048583	0.970	regulation of response to stimulus
GO:0051240	0.967	positive regulation of multicellular organismal process
GO:0090257	0.965	regulation of muscle system process
GO:0043502	0.964	regulation of muscle adaptation
GO:0014742	0.964	positive regulation of muscle hypertrophy
GO:0010611	0.952	regulation of cardiac muscle hypertrophy
GO:0010613	0.909	positive regulation of cardiac muscle hypertrophy
GO:1902903	0.877	regulation of supramolecular fiber organization
GO:0043254	0.851	regulation of protein-containing complex assembly
GO:0110053	0.816	regulation of actin filament organization
GO:1901879	0.795	regulation of protein depolymerization
GO:0032271	0.789	regulation of protein polymerization
GO:0030832	0.784	regulation of actin filament length
GO:0008064	0.769	regulation of actin polymerization or depolymerization
GO:0030833	0.730	regulation of actin filament polymerization
GO:0030834	0.728	regulation of actin filament depolymerization
GO:0071704	0.615	organic substance metabolic process
GO:0032501	0.591	multicellular organismal process
GO:0044237	0.550	cellular metabolic process
GO:0032502	0.546	developmental process
GO:0050896	0.540	response to stimulus
GO:0019222	0.539	regulation of metabolic process
GO:0048522	0.529	positive regulation of cellular process
GO:0060255	0.517	regulation of macromolecule metabolic process
GO:0048856	0.488	anatomical structure development
GO:0080090	0.440	regulation of primary metabolic process
GO:0007275	0.431	multicellular organism development
GO:0051716	0.416	cellular response to stimulus
GO:0031323	0.413	regulation of cellular metabolic process
GO:0051171	0.389	regulation of nitrogen compound metabolic process
GO:0007399	0.364	nervous system development
GO:0048519	0.350	negative regulation of biological process
GO:0048513	0.341	animal organ development
GO:0006807	0.339	nitrogen compound metabolic process
GO:0010468	0.300	regulation of gene expression
GO:0009893	0.300	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.976	organelle
GO:0043229	0.970	intracellular organelle
GO:0043227	0.948	membrane-bounded organelle
GO:0043231	0.942	intracellular membrane-bounded organelle
GO:0032991	0.917	protein-containing complex
GO:0043232	0.896	intracellular non-membrane-bounded organelle
GO:0005829	0.866	cytosol
GO:0005634	0.774	nucleus
GO:0015629	0.345	actin cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]