StarFunc result for job id P58743

User Input

>input (744 residues)
MDHAEENEILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPV
IMYCFLGTSRHISIGPFAVISLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAM
SVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGI
FSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG
TGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKT
LANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLM
ILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSL
FLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQI
NAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKADAEVD
GEDATKPEEEDGEVKYPPIVIKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGVKTL
AGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALWELLFHSIHDAVLGSQLREALA
EQEASAPPSQEDLEPNATPATPEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P58743	1.000	1.000	0.000	744	1.000	1.000	P58743.pdb.gz	S26A5_HUMAN Prestin OS=Homo sapiens OX=9606 GN=SLC26A5 PE=1 SV=1
2	PDB:7lguA	0.839	0.913	1.321E-86	680	0.913	0.999	7lguA.pdb.gz	Molecular mechanism of prestin electromotive signal amplification.
3	AFDB:Q7T2C4	0.864	0.869	5.714E-68	739	0.517	0.521	Q7T2C4.pdb.gz	S26A5_DANRE Prestin OS=Danio rerio OX=7955 GN=slc26a5 PE=2 SV=1
4	AFDB:Q9BXS9	0.838	0.822	5.160E-62	759	0.409	0.401	Q9BXS9.pdb.gz	S26A6_HUMAN Solute carrier family 26 member 6 OS=Homo sapiens OX=9606 GN=SLC26A6 PE=1 SV=1
5	AFDB:D3Z9I5	0.840	0.825	2.380E-61	758	0.397	0.389	D3Z9I5.pdb.gz	D3Z9I5_RAT Solute carrier family 26 member 6 OS=Rattus norvegicus OX=10116 GN=Slc26a6 PE=1 SV=1
6	AFDB:A9C3T3	0.852	0.848	6.787E-61	747	0.422	0.420	A9C3T3.pdb.gz	A9C3T3_DANRE Solute carrier family 26 member 6 OS=Danio rerio OX=7955 GN=slc26a6 PE=3 SV=2
7	AFDB:A9JTH4	0.852	0.786	1.111E-59	808	0.413	0.380	A9JTH4.pdb.gz	A9JTH4_DANRE Solute carrier family 26 member 6, like OS=Danio rerio OX=7955 GN=SLC26A6 PE=2 SV=1
8	AFDB:A0A2R8PVM0	0.823	0.858	1.266E-59	713	0.501	0.523	A0A2R8PVM0.pdb.gz
9	AFDB:Q9R154	0.853	0.814	3.168E-59	780	0.384	0.367	Q9R154.pdb.gz	S26A4_RAT Pendrin OS=Rattus norvegicus OX=10116 GN=Slc26a4 PE=1 SV=1
10	AFDB:C8XTB7	0.861	0.843	3.773E-59	760	0.367	0.359	C8XTB7.pdb.gz	C8XTB7_DANRE Pendrin OS=Danio rerio OX=7955 GN=si:dkey-31f5.9 PE=2 SV=1
11	AFDB:A0A2R8RSH7	0.851	0.880	7.264E-59	719	0.397	0.410	A0A2R8RSH7.pdb.gz
12	PDB:7ch1A	0.785	0.907	1.294E-48	640	0.329	0.383	7ch1A.pdb.gz	Structural insights into the gating mechanism of human SLC26A9 mediated by its C-terminal sequence.
13	PDB:4yzfA	0.375	0.548	2.423E-7	475	0.078	0.122	4yzfA.pdb.gz	Crystal structure of the anion exchanger domain of human erythrocyte band 3.
14	PDB:5i6cA	0.383	0.565	2.423E-7	480	0.085	0.131	5i6cA.pdb.gz	Structure of eukaryotic purine/H(+) symporter UapA suggests a role for homodimerization in transport activity.
15	PDB:8cs9g	0.396	0.360	3.015E-7	832	0.113	0.101	8cs9g.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
16	PDB:3qe7A	0.386	0.651	3.634E-6	407	0.067	0.123	3qe7A.pdb.gz	Structure and mechanism of the uracil transporter UraA
17	PDB:7tvzA	0.388	0.347	1.289E-5	850	0.112	0.098	7tvzA.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
18	PDB:6caaA	0.329	0.475	1.643E-3	477	0.069	0.107	6caaA.pdb.gz
19	PDB:2nq2A	0.100	0.194	3.984E-2	308	0.063	0.153	2nq2A.pdb.gz
20	PDB:5j4nA	0.113	0.160	8.372E-2	437	0.090	0.153	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A7HG43	0.0	560	783	0.401	0.381	A0A0A7HG43_ONCMY Slc26a6 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
2	A0A8I6AS58	0.0	570	704	0.395	0.418	A0A8I6AS58_RAT Solute carrier family 26 member 6 OS=Rattus norvegicus OX=10116 GN=Slc26a6 PE=1 SV=1
3	A9C3T3	0.0	589	747	0.415	0.414	A9C3T3_DANRE Solute carrier family 26 member 6 OS=Danio rerio OX=7955 GN=slc26a6 PE=3 SV=2
4	A9JTH4	0.0	547	808	0.356	0.328	A9JTH4_DANRE Solute carrier family 26 member 6, like OS=Danio rerio OX=7955 GN=SLC26A6 PE=2 SV=1
5	B6DUH7	0.0	546	745	0.386	0.385	B6DUH7_DANRE Chloride anion exchanger OS=Danio rerio OX=7955 GN=si:dkey-31f5.2 PE=2 SV=1
6	D3Z9I5	0.0	563	758	0.407	0.400	D3Z9I5_RAT Solute carrier family 26 member 6 OS=Rattus norvegicus OX=10116 GN=Slc26a6 PE=1 SV=1
7	P58743	0.0	1521	744	1.000	1.000	S26A5_HUMAN Prestin OS=Homo sapiens OX=9606 GN=SLC26A5 PE=1 SV=1
8	Q7T2C4	0.0	734	739	0.523	0.526	S26A5_DANRE Prestin OS=Danio rerio OX=7955 GN=slc26a5 PE=2 SV=1
9	Q8CIW6	0.0	557	758	0.410	0.402	S26A6_MOUSE Solute carrier family 26 member 6 OS=Mus musculus OX=10090 GN=Slc26a6 PE=1 SV=2
10	Q99NH7	0.0	1449	744	0.950	0.950	S26A5_MOUSE Prestin OS=Mus musculus OX=10090 GN=Slc26a5 PE=1 SV=3
11	Q9BXS9	0.0	549	759	0.403	0.395	S26A6_HUMAN Solute carrier family 26 member 6 OS=Homo sapiens OX=9606 GN=SLC26A6 PE=1 SV=1
12	Q9EPH0	0.0	1446	744	0.945	0.945	S26A5_RAT Prestin OS=Rattus norvegicus OX=10116 GN=Slc26a5 PE=1 SV=1
13	C8XTB7	2.90e-177	528	760	0.371	0.363	C8XTB7_DANRE Pendrin OS=Danio rerio OX=7955 GN=si:dkey-31f5.9 PE=2 SV=1
14	O43511	2.75e-176	526	780	0.374	0.356	S26A4_HUMAN Pendrin OS=Homo sapiens OX=9606 GN=SLC26A4 PE=1 SV=1
15	P40879	6.85e-176	524	764	0.386	0.376	S26A3_HUMAN Chloride anion exchanger OS=Homo sapiens OX=9606 GN=SLC26A3 PE=1 SV=1
16	Q9R155	3.05e-170	510	780	0.370	0.353	S26A4_MOUSE Pendrin OS=Mus musculus OX=10090 GN=Slc26a4 PE=1 SV=1
17	Q9R154	7.45e-169	507	780	0.370	0.353	S26A4_RAT Pendrin OS=Rattus norvegicus OX=10116 GN=Slc26a4 PE=1 SV=1
18	Q924C9	9.25e-167	501	757	0.371	0.365	S26A3_RAT Chloride anion exchanger OS=Rattus norvegicus OX=10116 GN=Slc26a3 PE=2 SV=1
19	Q9WVC8	8.86e-163	490	757	0.372	0.366	S26A3_MOUSE Chloride anion exchanger OS=Mus musculus OX=10090 GN=Slc26a3 PE=1 SV=1
20	Q7LBE3	1.51e-158	481	791	0.368	0.346	S26A9_HUMAN Solute carrier family 26 member 9 OS=Homo sapiens OX=9606 GN=SLC26A9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01740 STAS	1.9e-19	80.8	STAS domain
2	PF00916 Sulfate_transp	6.6e-104	359.3	Sulfate permease family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304783

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000003084	0.911	Cystic fibrosis transmembrane conductance regulator
2	9606.ENSP00000338157	0.876	Zinc finger and BTB domain-containing protein 16
3	9606.ENSP00000225719	0.843	M14 carboxypeptidases
4	9606.ENSP00000257627	0.761	Putative oncomodulin-2
5	9606.ENSP00000242104	0.760	Oncomodulin-1
6	9606.ENSP00000482885	0.760	Phosphatidylinositol phosphatase PTPRQ
7	9606.ENSP00000283228	0.754	Receptor-type tyrosine-protein phosphatase R
8	9606.ENSP00000348772	0.710	Membrane-associated phosphatidylinositol transfer protein 1
9	9606.ENSP00000366525	0.706	Ferritin light chain
10	9606.ENSP00000297784	0.695	Transmembrane channel-like protein 1
11	9606.ENSP00000366267	0.650	Glypican-5
12	9606.ENSP00000272371	0.647	Otoferlin
13	9606.ENSP00000273063	0.647	Anion exchange protein 3
14	9606.ENSP00000366641	0.647	Solute carrier family 2, facilitated glucose transporter member 5
15	9606.ENSP00000216540	0.636	Sodium/bile acid cotransporter
16	9606.ENSP00000262916	0.635	Potassium voltage-gated channel subfamily KQT member 4
17	9606.ENSP00000386331	0.629	Unconventional myosin-VIIa
18	9606.ENSP00000230732	0.616	POU domain, class 4, transcription factor 3
19	9606.ENSP00000259467	0.605	Phosducin-like protein
20	9606.ENSP00000302327	0.605	Pygopus homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901702	1.000	salt transmembrane transporter activity
GO:0015103	1.000	inorganic anion transmembrane transporter activity
GO:0005515	0.998	protein binding
GO:0015075	0.982	monoatomic ion transmembrane transporter activity
GO:0008514	0.927	organic anion transmembrane transporter activity
GO:0015291	0.914	secondary active transmembrane transporter activity
GO:0015116	0.912	sulfate transmembrane transporter activity
GO:0008509	0.838	monoatomic anion transmembrane transporter activity
GO:0015108	0.597	chloride transmembrane transporter activity
GO:0015106	0.358	bicarbonate transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.940	multicellular organismal process
GO:0006810	0.891	transport
GO:0065007	0.876	biological regulation
GO:0050954	0.798	sensory perception of mechanical stimulus
GO:0065008	0.759	regulation of biological quality
GO:0007605	0.741	sensory perception of sound
GO:0009987	0.612	cellular process
GO:0050789	0.549	regulation of biological process
GO:0050794	0.476	regulation of cellular process
GO:0006811	0.389	monoatomic ion transport
GO:0050896	0.341	response to stimulus
GO:0015698	0.324	inorganic anion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.940	intracellular anatomical structure
GO:0098590	0.893	plasma membrane region
GO:0043226	0.764	organelle
GO:0005737	0.716	cytoplasm
GO:0043227	0.672	membrane-bounded organelle
GO:0043231	0.635	intracellular membrane-bounded organelle
GO:0009925	0.342	basal plasma membrane
GO:0016323	0.333	basolateral plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34983	0.912	sulfate(in) = sulfate(out)
RHEA:29823	0.597	chloride(in) = chloride(out)
RHEA:28695	0.358	hydrogencarbonate(in) = hydrogencarbonate(out)

[back to server]