StarFunc result for job id P58753

User Input

>input (221 residues)
MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPS
LSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQL
RDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLS
GLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P58753	1.000	1.000	2.425E-39	221	1.000	1.000	P58753.pdb.gz	TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adapter protein OS=Homo sapiens OX=9606 GN=TIRAP PE=1 SV=2
2	AFDB:Q99JY1	0.676	0.623	3.484E-29	241	0.792	0.726	Q99JY1.pdb.gz	TIRAP_MOUSE Toll/interleukin-1 receptor domain-containing adapter protein OS=Mus musculus OX=10090 GN=Tirap PE=1 SV=1
3	AFDB:Q9VPH1	0.527	0.146	1.497E-7	900	0.127	0.031	Q9VPH1.pdb.gz	Q9VPH1_DROME Toll-9, isoform A OS=Drosophila melanogaster OX=7227 GN=Toll-9 PE=3 SV=1
4	AFDB:Q8BJQ4	0.506	0.484	5.882E-7	232	0.199	0.190	Q8BJQ4.pdb.gz	TCAM2_MOUSE TIR domain-containing adapter molecule 2 OS=Mus musculus OX=10090 GN=Ticam2 PE=1 SV=1
5	AFDB:Q86XR7	0.505	0.477	6.626E-7	235	0.181	0.170	Q86XR7.pdb.gz	TCAM2_HUMAN TIR domain-containing adapter molecule 2 OS=Homo sapiens OX=9606 GN=TICAM2 PE=1 SV=1
6	AFDB:I1GTC2	0.484	0.478	8.407E-7	224	0.167	0.165	I1GTC2.pdb.gz	BDTIR_BRADI Probable 2' cyclic ADP-D-ribose synthase BdTIR OS=Brachypodium distachyon OX=15368 GN=BRADI_1g24377v3 PE=1 SV=1
7	AFDB:W8W3P0	0.481	0.124	1.132E-6	941	0.167	0.039	W8W3P0.pdb.gz	W8W3P0_SALSA TLR20d protein OS=Salmo salar OX=8030 GN=TLR PE=2 SV=1
8	AFDB:Q80UF7	0.472	0.163	1.822E-6	732	0.285	0.086	Q80UF7.pdb.gz	TCAM1_MOUSE TIR domain-containing adapter molecule 1 OS=Mus musculus OX=10090 GN=Ticam1 PE=1 SV=1
9	AFDB:Q9VIA4	0.524	0.130	1.822E-6	965	0.131	0.030	Q9VIA4.pdb.gz	Q9VIA4_DROME MstProx OS=Drosophila melanogaster OX=7227 GN=MstProx PE=4 SV=3
10	AFDB:A0A2R3VHL5	0.498	0.140	4.722E-6	881	0.145	0.036	A0A2R3VHL5.pdb.gz
11	PDB:3j0aA	0.445	0.139	9.739E-5	797	0.131	0.036	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
12	PDB:7anwA	0.454	0.171	1.909E-3	645	0.145	0.050	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
13	PDB:7cm7A	0.391	0.162	4.661E-3	620	0.113	0.040	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
14	PDB:7jlxA	0.377	0.488	9.520E-3	166	0.109	0.145	7jlxA.pdb.gz
15	PDB:3jrnA	0.316	0.452	1.208E-2	151	0.095	0.139	3jrnA.pdb.gz
16	PDB:2i2wA	0.296	0.330	6.393E-2	192	0.077	0.089	2i2wA.pdb.gz
17	PDB:2yc4C	0.353	0.421	7.643E-2	177	0.081	0.102	2yc4C.pdb.gz	Crystal Structure of the Intraflagellar Transport Complex 25/27.
18	PDB:2yvaA	0.306	0.338	1.306E-1	193	0.072	0.083	2yvaA.pdb.gz
19	PDB:4d02A	0.314	0.201	1.306E-1	399	0.077	0.043	4d02A.pdb.gz	Structure of Escherichia Coli Flavodiiron Nitric Oxide Reductase.
20	PDB:6xp1B	0.282	0.233	1.386E-1	281	0.054	0.043	6xp1B.pdb.gz	In crystallo screening for proline analog inhibitors of the proline cycle enzyme PYCR1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P58753	6.50e-162	447	221	1.000	1.000	TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adapter protein OS=Homo sapiens OX=9606 GN=TIRAP PE=1 SV=2
2	Q99JY1	1.85e-105	305	241	0.747	0.685	TIRAP_MOUSE Toll/interleukin-1 receptor domain-containing adapter protein OS=Mus musculus OX=10090 GN=Tirap PE=1 SV=1
3	Q99836	8.77e-08	53.5	296	0.186	0.139	MYD88_HUMAN Myeloid differentiation primary response protein MyD88 OS=Homo sapiens OX=9606 GN=MYD88 PE=1 SV=1
4	A5HNF6	1.02e-07	53.5	299	0.199	0.147	MYD88_CHICK Myeloid differentiation primary response protein MyD88 OS=Gallus gallus OX=9031 GN=MYD88 PE=1 SV=1
5	P22366	1.13e-07	53.5	296	0.213	0.159	MYD88_MOUSE Myeloid differentiation primary response protein MyD88 OS=Mus musculus OX=10090 GN=Myd88 PE=1 SV=3
6	Q6YGU2	2.88e-07	52.8	784	0.113	0.032	Q6YGU2_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=2 SV=1
7	E9PTD9	2.90e-07	52.8	784	0.113	0.032	E9PTD9_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=1 SV=1
8	Q6Y1S1	4.74e-07	51.6	296	0.145	0.108	MYD88_RAT Myeloid differentiation primary response protein MyD88 OS=Rattus norvegicus OX=10116 GN=Myd88 PE=2 SV=2
9	Q9QUN7	5.11e-07	52.0	784	0.140	0.040	TLR2_MOUSE Toll-like receptor 2 OS=Mus musculus OX=10090 GN=Tlr2 PE=1 SV=1
10	Q9DD78	4.94e-06	48.9	793	0.113	0.032	TLR21_CHICK Toll-like receptor 2 type-1 OS=Gallus gallus OX=9031 GN=TLR2-1 PE=2 SV=1
11	O60603	8.04e-06	48.5	784	0.109	0.031	TLR2_HUMAN Toll-like receptor 2 OS=Homo sapiens OX=9606 GN=TLR2 PE=1 SV=1
12	Q5XJ85	1.01e-05	47.4	284	0.136	0.106	MYD88_DANRE Myeloid differentiation primary response protein MyD88 OS=Danio rerio OX=7955 GN=myd88 PE=2 SV=2
13	Q4LBC6	3.81e-05	45.8	282	0.136	0.106	MYD88_ONCMY Myeloid differentiation primary response protein MyD88 OS=Oncorhynchus mykiss OX=8022 GN=myd88 PE=2 SV=1
14	S6FDG5	8.97e-05	44.7	283	0.136	0.106	S6FDG5_ONCMY Myeloid differentiation primary response protein MyD88 OS=Oncorhynchus mykiss OX=8022 GN=MYD88 PE=4 SV=1
15	A5H0S2	1.59e-04	44.3	652	0.090	0.031	A5H0S2_CHICK Toll-like receptor 1-like protein b OS=Gallus gallus OX=9031 GN=TLR1Lb PE=2 SV=1
16	Q9Y2C9	2.18e-04	43.9	796	0.095	0.026	TLR6_HUMAN Toll-like receptor 6 OS=Homo sapiens OX=9606 GN=TLR6 PE=1 SV=2
17	Q7K105	4.04e-04	43.1	537	0.127	0.052	Q7K105_DROME LD20892p OS=Drosophila melanogaster OX=7227 GN=Myd88 PE=1 SV=1
18	F1QWS9	4.85e-04	43.1	818	0.100	0.027	F1QWS9_DANRE Toll-like receptor 2 OS=Danio rerio OX=7955 GN=tlr2 PE=3 SV=1
19	B3SRQ2	4.88e-04	42.4	283	0.136	0.106	MYD88_SALSA Myeloid differentiation primary response protein MyD88 OS=Salmo salar OX=8030 GN=myd88 PE=2 SV=1
20	Q6TS42	5.84e-04	42.7	788	0.100	0.028	Q6TS42_DANRE Toll-like receptor 2 OS=Danio rerio OX=7955 GN=tlr2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01582 TIR	0.08	24.2	TIR domain
2	PF13676 TIR_2	2.2e-11	55.8	TIR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000007613

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000036398	0.996	Pan troglodytes toll-like receptor 4 (TLR4), mRNA
2	9598.ENSPTRP00000006096	0.994	Belongs to the TNF receptor-associated factor family.
3	9598.ENSPTRP00000025449	0.990	Myeloid differentiation primary response protein MyD88
4	9598.ENSPTRP00000028379	0.988	Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Cooperates with TLR1 or TLR6 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (By similarity). May also promote apoptosis in response to lipoproteins. Forms activation clusters composed of several receptors depending on the ligand, these clusters trigger signaling from the cell surface and subsequently are targeted to the [...]
5	9598.ENSPTRP00000008285	0.985	Interleukin-1 receptor-associated kinase 4
6	9598.ENSPTRP00000034831	0.980	Pan troglodytes lymphocyte antigen 96 (LY96), mRNA
7	9598.ENSPTRP00000027517	0.971	Pan troglodytes toll-like receptor 6 (TLR6), mRNA
8	9598.ENSPTRP00000041179	0.960	Uncharacterized protein
9	9598.ENSPTRP00000025212	0.932	Uncharacterized protein
10	9598.ENSPTRP00000038647	0.910	Interleukin-1 receptor-associated kinase 1
11	9598.ENSPTRP00000027516	0.899	Pan troglodytes toll-like receptor 1 (TLR1), mRNA
12	9598.ENSPTRP00000028569	0.885	Pan troglodytes toll-like receptor 3 (TLR3), mRNA
13	9598.ENSPTRP00000006883	0.878	FAS-associated death domain protein
14	9598.ENSPTRP00000015218	0.793	Uncharacterized protein
15	9598.ENSPTRP00000047493	0.786	Uncharacterized protein
16	9598.ENSPTRP00000047494	0.786	Uncharacterized protein
17	9598.ENSPTRP00000055512	0.764	Conserved helix-loop-helix ubiquitous kinase
18	9598.ENSPTRP00000034600	0.759	Inhibitor of nuclear factor kappa B kinase subunit beta
19	9598.ENSPTRP00000027515	0.746	Pan troglodytes toll-like receptor 10 (TLR10), mRNA
20	9598.ENSPTRP00000061184	0.746	Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding
GO:0005102	0.999	signaling receptor binding
GO:0005080	0.999	protein kinase C binding
GO:0035325	0.750	Toll-like receptor binding
GO:0035663	0.694	Toll-like receptor 2 binding
GO:0003824	0.473	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0048522	0.992	positive regulation of cellular process
GO:0010604	0.990	positive regulation of macromolecule metabolic process
GO:0002682	0.986	regulation of immune system process
GO:0032675	0.986	regulation of interleukin-6 production
GO:0031349	0.986	positive regulation of defense response
GO:0019219	0.986	regulation of nucleobase-containing compound metabolic process
GO:0007165	0.986	signal transduction
GO:0042221	0.985	response to chemical
GO:0044093	0.985	positive regulation of molecular function
GO:0002831	0.985	regulation of response to biotic stimulus
GO:0010556	0.985	regulation of macromolecule biosynthetic process
GO:0032103	0.985	positive regulation of response to external stimulus
GO:0031326	0.985	regulation of cellular biosynthetic process
GO:0009966	0.985	regulation of signal transduction
GO:0002376	0.983	immune system process
GO:0009605	0.982	response to external stimulus
GO:0051092	0.982	positive regulation of NF-kappaB transcription factor activity
GO:0010033	0.981	response to organic substance
GO:0009967	0.978	positive regulation of signal transduction
GO:0032677	0.976	regulation of interleukin-8 production
GO:0045089	0.976	positive regulation of innate immune response
GO:0032755	0.974	positive regulation of interleukin-6 production
GO:0032680	0.970	regulation of tumor necrosis factor production
GO:0009617	0.965	response to bacterium
GO:0032757	0.964	positive regulation of interleukin-8 production
GO:0032760	0.961	positive regulation of tumor necrosis factor production
GO:0002237	0.956	response to molecule of bacterial origin
GO:1902533	0.956	positive regulation of intracellular signal transduction
GO:1901700	0.954	response to oxygen-containing compound
GO:0007166	0.952	cell surface receptor signaling pathway
GO:0062207	0.947	regulation of pattern recognition receptor signaling pathway
GO:0035556	0.945	intracellular signal transduction
GO:0062208	0.943	positive regulation of pattern recognition receptor signaling pathway
GO:0043123	0.940	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0002218	0.925	activation of innate immune response
GO:0051247	0.923	positive regulation of protein metabolic process
GO:0002221	0.920	pattern recognition receptor signaling pathway
GO:0048519	0.908	negative regulation of biological process
GO:0031325	0.895	positive regulation of cellular metabolic process
GO:0048523	0.888	negative regulation of cellular process
GO:0050790	0.862	regulation of catalytic activity
GO:0043408	0.856	regulation of MAPK cascade
GO:0002224	0.856	toll-like receptor signaling pathway
GO:0042325	0.851	regulation of phosphorylation
GO:0009892	0.837	negative regulation of metabolic process
GO:0010605	0.834	negative regulation of macromolecule metabolic process
GO:0006950	0.815	response to stress
GO:0065008	0.802	regulation of biological quality
GO:0051128	0.780	regulation of cellular component organization
GO:0043410	0.775	positive regulation of MAPK cascade
GO:0070887	0.768	cellular response to chemical stimulus
GO:0071310	0.722	cellular response to organic substance
GO:0032874	0.679	positive regulation of stress-activated MAPK cascade
GO:0032496	0.563	response to lipopolysaccharide
GO:0006952	0.452	defense response
GO:0098542	0.400	defense response to other organism
GO:0006955	0.335	immune response
GO:0008152	0.300	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0005829	0.991	cytosol
GO:0043229	0.959	intracellular organelle
GO:0043231	0.946	intracellular membrane-bounded organelle
GO:0031982	0.610	vesicle
GO:0031410	0.599	cytoplasmic vesicle
GO:0012505	0.426	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]