StarFunc result for job id P59044

User Input

>input (892 residues)
MDQPEAPCSSTGPRLAVARELLLAALEELSQEQLKRFRHKLRDVGPDGRSIPWGRLERAD
AVDLAEQLAQFYGPEPALEVARKTLKRADARDVAAQLQERRLQRLGLGSGTLLSVSEYKK
KYREHVLQLHARVKERNARSVKITKRFTKLLIAPESAAPEEAMGPAEEPEPGRARRSDTH
TFNRLFRRDEEGRRPLTVVLQGPAGIGKTMAAKKILYDWAAGKLYQGQVDFAFFMPCGEL
LERPGTRSLADLILDQCPDRGAPVPQMLAQPQRLLFILDGADELPALGGPEAAPCTDPFE
AASGARVLGGLLSKALLPTALLLVTTRAAAPGRLQGRLCSPQCAEVRGFSDKDKKKYFYK
YFRDERRAERAYRFVKENETLFALCFVPFVCWIVCTVLRQQLELGRDLSRTSKTTTSVYL
LFITSVLSSAPVADGPRLQGDLRNLCRLAREGVLGRRAQFAEKELEQLELRGSKVQTLFL
SKKELPGVLETEVTYQFIDQSFQEFLAALSYLLEDGGVPRTAAGGVGTLLRGDAQPHSHL
VLTTRFLFGLLSAERMRDIERHFGCMVSERVKQEALRWVQGQGQGCPGVAPEVTEGAKGL
EDTEEPEEEEEGEEPNYPLELLYCLYETQEDAFVRQALCRFPELALQRVRFCRMDVAVLS
YCVRCCPAGQALRLISCRLVAAQEKKKKSLGKRLQASLGGGSSSQGTTKQLPASLLHPLF
QAMTDPLCHLSSLTLSHCKLPDAVCRDLSEALRAAPALTELGLLHNRLSEAGLRMLSEGL
AWPQCRVQTVRVQLPDPQRGLQYLVGMLRQSPALTTLDLSGCQLPAPMVTYLCAVLQHQG
CGLQTLSLASVELSEQSLQELQAVKRAKPDLVITHPALDGHPQPPKELISTF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59044	1.000	1.000	0.000	892	1.000	1.000	P59044.pdb.gz	NLRP6_HUMAN NACHT, LRR and PYD domains-containing protein 6 OS=Homo sapiens OX=9606 GN=NLRP6 PE=1 SV=2
2	AFDB:Q63035	0.818	0.828	3.483E-104	881	0.710	0.719	Q63035.pdb.gz	NLRP6_RAT NACHT, LRR and PYD domains-containing protein 6 OS=Rattus norvegicus OX=10116 GN=Nlrp6 PE=1 SV=4
3	AFDB:Q91WS2	0.807	0.828	1.073E-99	869	0.694	0.712	Q91WS2.pdb.gz	NLRP6_MOUSE NACHT, LRR and PYD domains-containing protein 6 OS=Mus musculus OX=10090 GN=Nlrp6 PE=1 SV=3
4	AFDB:D4A523	0.566	0.491	4.689E-59	1035	0.341	0.294	D4A523.pdb.gz	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
5	AFDB:Q96P20	0.469	0.414	2.019E-55	1036	0.331	0.285	Q96P20.pdb.gz	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
6	AFDB:P59046	0.458	0.395	3.951E-52	1061	0.333	0.280	P59046.pdb.gz	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
7	AFDB:E9Q5R7	0.414	0.359	1.913E-51	1054	0.312	0.264	E9Q5R7.pdb.gz	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
8	AFDB:Q86W24	0.372	0.317	4.226E-44	1093	0.294	0.240	Q86W24.pdb.gz	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
9	AFDB:F1MT67	0.422	0.352	3.443E-41	1098	0.275	0.223	F1MT67.pdb.gz	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
10	AFDB:P59047	0.410	0.317	4.103E-41	1200	0.260	0.193	P59047.pdb.gz	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
11	PDB:7pzcA	0.345	0.309	7.058E-39	1010	0.332	0.293	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
12	PDB:7lfhA	0.317	0.347	2.624E-29	806	0.288	0.319	7lfhA.pdb.gz
13	PDB:6npyA	0.333	0.362	7.079E-23	798	0.253	0.283	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
14	PDB:4kxfP	0.290	0.298	5.881E-19	866	0.151	0.156	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
15	PDB:3jblA	0.340	0.334	8.223E-13	909	0.159	0.156	3jblA.pdb.gz
16	PDB:6b5bA	0.331	0.259	1.357E-11	1199	0.179	0.133	6b5bA.pdb.gz
17	PDB:5yudA	0.385	0.303	5.001E-7	1238	0.161	0.116	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
18	PDB:1a4yA	0.163	0.275	5.099E-6	460	0.070	0.135	1a4yA.pdb.gz
19	PDB:6ndjB	0.080	0.159	1.122E-5	443	0.083	0.167	6ndjB.pdb.gz
20	PDB:3sfzA	0.179	0.145	3.662E-5	1133	0.071	0.056	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59044	0.0	1789	892	1.000	1.000	NLRP6_HUMAN NACHT, LRR and PYD domains-containing protein 6 OS=Homo sapiens OX=9606 GN=NLRP6 PE=1 SV=2
2	Q63035	0.0	1185	881	0.721	0.730	NLRP6_RAT NACHT, LRR and PYD domains-containing protein 6 OS=Rattus norvegicus OX=10116 GN=Nlrp6 PE=1 SV=4
3	Q91WS2	0.0	1143	869	0.693	0.711	NLRP6_MOUSE NACHT, LRR and PYD domains-containing protein 6 OS=Mus musculus OX=10090 GN=Nlrp6 PE=1 SV=3
4	Q8R4B8	7.70e-133	425	1033	0.344	0.297	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
5	P59046	1.25e-130	420	1061	0.337	0.284	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
6	D4A523	3.51e-129	416	1035	0.348	0.300	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
7	Q96P20	2.56e-124	403	1036	0.340	0.292	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
8	E9Q5R7	3.16e-117	384	1054	0.322	0.272	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
9	Q86W24	1.56e-101	342	1093	0.296	0.242	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
10	Q96MN2	3.73e-89	306	994	0.270	0.242	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
11	Q9C000	6.61e-85	300	1473	0.285	0.172	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1 OS=Homo sapiens OX=9606 GN=NLRP1 PE=1 SV=1
12	J3KN39	1.70e-72	261	1059	0.299	0.252	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
13	Q9NX02	3.43e-72	259	1062	0.257	0.216	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
14	Q2LKU9	1.30e-70	256	1182	0.223	0.168	NLR1A_MOUSE NACHT, LRR and PYD domains-containing protein 1a OS=Mus musculus OX=10090 GN=Nlrp1a PE=1 SV=1
15	D9I2G4	3.45e-70	255	1218	0.243	0.178	NL1A5_RAT NACHT, LRR and PYD domains-containing protein 1a allele 5 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
16	Q7RTR0	3.71e-70	253	991	0.253	0.228	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
17	Q86W26	6.03e-70	246	655	0.206	0.281	NAL10_HUMAN NACHT, LRR and PYD domains-containing protein 10 OS=Homo sapiens OX=9606 GN=NLRP10 PE=1 SV=1
18	D9I2G1	3.89e-69	252	1218	0.242	0.177	NL1A4_RAT NACHT, LRR and PYD domains-containing protein 1a allele 4 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
19	D9I2H0	1.70e-68	250	1218	0.241	0.177	NL1A3_RAT NACHT, LRR and PYD domains-containing protein 1a allele 3 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
20	D9I2F9	1.81e-68	250	1218	0.241	0.177	NL1A1_RAT NACHT, LRR and PYD domains-containing protein 1a allele 1 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	4.5	19.1	AAA ATPase domain
2	PF13516 LRR_6	1.8e+02	13.7	Leucine Rich repeat
3	PF05729 NACHT	1.7e-41	153.4	NACHT domain
4	PF17776 NLRC4_HD2	5.5e-15	67.5	NLRC4 helical domain HD2
5	PF17779 NOD2_WH	0.0002	32.8	NOD2 winged helix domain
6	PF02758 PYRIN	2.7e-16	70.8	PAAD/DAPIN/Pyrin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309767

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385090	0.979	NLR family CARD domain-containing protein 4
2	9606.ENSP00000433138	0.963	Caspase-1
3	9606.ENSP00000247470	0.962	Apoptosis-associated speck-like protein containing a CARD
4	9606.ENSP00000357112	0.947	Interferon-inducible protein AIM2
5	9606.ENSP00000336741	0.893	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15
6	9606.ENSP00000428657	0.854	Baculoviral IAP repeat-containing protein 1
7	9606.ENSP00000433209	0.797	Gasdermin-D
8	9606.ENSP00000376849	0.794	Caspase-5
9	9606.ENSP00000225296	0.789	Putative ATP-dependent RNA helicase DHX33
10	9606.ENSP00000219596	0.784	Pyrin
11	9606.ENSP00000280357	0.739	Interleukin-18
12	9606.ENSP00000375767	0.706	Caspase recruitment domain-containing protein 8
13	9606.ENSP00000388566	0.671	Caspase-4
14	9606.ENSP00000263341	0.651	Interleukin-1 beta
15	9606.ENSP00000478516	0.648	NACHT, LRR and PYD domains-containing protein 1
16	9606.ENSP00000337383	0.633	NACHT, LRR and PYD domains-containing protein 3
17	9606.ENSP00000331857	0.630	NACHT, LRR and PYD domains-containing protein 9
18	9606.ENSP00000357113	0.601	Gamma-interferon-inducible protein 16
19	9606.ENSP00000382840	0.601	ATP-dependent RNA helicase DDX3X
20	9606.ENSP00000346120	0.559	Nucleolar RNA helicase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0097159	0.988	organic cyclic compound binding
GO:1901363	0.987	heterocyclic compound binding
GO:0038023	0.973	signaling receptor activity
GO:0097367	0.971	carbohydrate derivative binding
GO:0003676	0.961	nucleic acid binding
GO:0003723	0.906	RNA binding
GO:0140693	0.900	molecular condensate scaffold activity
GO:0003725	0.758	double-stranded RNA binding
GO:0038187	0.731	pattern recognition receptor activity
GO:0070891	0.722	lipoteichoic acid binding
GO:0008289	0.687	lipid binding
GO:0003824	0.663	catalytic activity
GO:0016787	0.524	hydrolase activity
GO:0001530	0.346	lipopolysaccharide binding
GO:0042802	0.309	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.998	cellular process
GO:0050789	0.998	regulation of biological process
GO:0048583	0.994	regulation of response to stimulus
GO:0050794	0.991	regulation of cellular process
GO:0051707	0.990	response to other organism
GO:0048518	0.989	positive regulation of biological process
GO:0006952	0.987	defense response
GO:0002376	0.984	immune system process
GO:0023051	0.982	regulation of signaling
GO:0080134	0.982	regulation of response to stress
GO:0010646	0.981	regulation of cell communication
GO:0048584	0.981	positive regulation of response to stimulus
GO:0048522	0.960	positive regulation of cellular process
GO:0060759	0.955	regulation of response to cytokine stimulus
GO:0032101	0.954	regulation of response to external stimulus
GO:0006955	0.949	immune response
GO:0031347	0.949	regulation of defense response
GO:0009966	0.946	regulation of signal transduction
GO:0031349	0.942	positive regulation of defense response
GO:0032103	0.939	positive regulation of response to external stimulus
GO:0050727	0.938	regulation of inflammatory response
GO:0140374	0.938	antiviral innate immune response
GO:0050729	0.933	positive regulation of inflammatory response
GO:0009967	0.920	positive regulation of signal transduction
GO:0009617	0.894	response to bacterium
GO:0019222	0.876	regulation of metabolic process
GO:0060255	0.870	regulation of macromolecule metabolic process
GO:0071840	0.861	cellular component organization or biogenesis
GO:0060760	0.856	positive regulation of response to cytokine stimulus
GO:0010604	0.856	positive regulation of macromolecule metabolic process
GO:0043933	0.849	protein-containing complex organization
GO:0051171	0.848	regulation of nitrogen compound metabolic process
GO:0001959	0.838	regulation of cytokine-mediated signaling pathway
GO:0022607	0.825	cellular component assembly
GO:0080090	0.809	regulation of primary metabolic process
GO:0010468	0.803	regulation of gene expression
GO:0065003	0.796	protein-containing complex assembly
GO:0051716	0.788	cellular response to stimulus
GO:0042742	0.773	defense response to bacterium
GO:0051260	0.770	protein homooligomerization
GO:0051239	0.754	regulation of multicellular organismal process
GO:0065009	0.753	regulation of molecular function
GO:0001817	0.735	regulation of cytokine production
GO:0001961	0.719	positive regulation of cytokine-mediated signaling pathway
GO:0031323	0.658	regulation of cellular metabolic process
GO:0051240	0.649	positive regulation of multicellular organismal process
GO:0001819	0.641	positive regulation of cytokine production
GO:0042221	0.582	response to chemical
GO:0010033	0.574	response to organic substance
GO:0051173	0.558	positive regulation of nitrogen compound metabolic process
GO:0071704	0.556	organic substance metabolic process
GO:0044238	0.505	primary metabolic process
GO:0051246	0.505	regulation of protein metabolic process
GO:0006807	0.489	nitrogen compound metabolic process
GO:0044093	0.478	positive regulation of molecular function
GO:0009889	0.469	regulation of biosynthetic process
GO:0010556	0.459	regulation of macromolecule biosynthetic process
GO:0043170	0.453	macromolecule metabolic process
GO:0031326	0.445	regulation of cellular biosynthetic process
GO:0019219	0.445	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.435	negative regulation of biological process
GO:1902531	0.435	regulation of intracellular signal transduction
GO:0070887	0.427	cellular response to chemical stimulus
GO:0007165	0.402	signal transduction
GO:0052547	0.400	regulation of peptidase activity
GO:2001141	0.400	regulation of RNA biosynthetic process
GO:0032652	0.386	regulation of interleukin-1 production
GO:0048523	0.385	negative regulation of cellular process
GO:1903506	0.383	regulation of nucleic acid-templated transcription
GO:0006355	0.371	regulation of DNA-templated transcription
GO:0032651	0.363	regulation of interleukin-1 beta production
GO:0032732	0.361	positive regulation of interleukin-1 production
GO:0012501	0.359	programmed cell death
GO:0043085	0.358	positive regulation of catalytic activity
GO:0051247	0.358	positive regulation of protein metabolic process
GO:2000116	0.357	regulation of cysteine-type endopeptidase activity
GO:0071310	0.348	cellular response to organic substance
GO:0010950	0.337	positive regulation of endopeptidase activity
GO:1901564	0.331	organonitrogen compound metabolic process
GO:2001056	0.329	positive regulation of cysteine-type endopeptidase activity
GO:0002682	0.326	regulation of immune system process
GO:0050776	0.317	regulation of immune response
GO:0048585	0.312	negative regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	1.000	organelle
GO:0061702	0.998	inflammasome complex
GO:0043228	0.994	non-membrane-bounded organelle
GO:0043229	0.989	intracellular organelle
GO:0043232	0.963	intracellular non-membrane-bounded organelle
GO:0043231	0.958	intracellular membrane-bounded organelle
GO:0016020	0.859	membrane
GO:0005634	0.680	nucleus
GO:0071944	0.678	cell periphery
GO:0070013	0.486	intracellular organelle lumen
GO:0031981	0.474	nuclear lumen
GO:0140738	0.391	NLRP6 inflammasome complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.524	Hydrolases.

[back to server]