StarFunc result for job id P59045

User Input

>input (1033 residues)
MAESDSTDFDLLWYLENLSDKEFQSFKKYLARKILDFKLPQFPLIQMTKEELANVLPISY
EGQYIWNMLFSIFSMMRKEDLCRKIIGRRNRNQEACKAVMRRKFMLQWESHTFGKFHYKF
FRDVSSDVFYILQLAYDSTSYYSANNLNVFLMGERASGKTIVINLAVLRWIKGEMWQNMI
SYVVHLTAHEINQMTNSSLAELIAKDWPDGQAPIADILSDPKKLLFILEDLDNIRFELNV
NESALCSNSTQKVPIPVLLVSLLKRKMAPGCWFLISSRPTRGNNVKTFLKEVDCCTTLQL
SNGKREIYFNSFFKDRQRASAALQLVHEDEILVGLCRVAILCWITCTVLKRQMDKGRDFQ
LCCQTPTDLHAHFLADALTSEAGLTANQYHLGLLKRLCLLAAGGLFLSTLNFSGEDLRCV
GFTEADVSVLQAANILLPSNTHKDRYKFIHLNVQEFCTAIAFLMAVPNYLIPSGSREYKE
KREQYSDFNQVFTFIFGLLNANRRKILETSFGYQLPMVDSFKWYSVGYMKHLDRDPEKLT
HHMPLFYCLYENREEEFVKTIVDALMEVTVYLQSDKDMMVSLYCLDYCCHLRTLKLSVQR
IFQNKEPLIRPTASQMKSLVYWREICSLFYTMESLRELHIFDNDLNGISERILSKALEHS
SCKLRTLKLSYVSTASGFEDLLKALARNRSLTYLSINCTSISLNMFSLLHDILHEPTCQI
SHLSLMKCDLRASECEEIASLLISGGSLRKLTLSSNPLRSDGMNILCDALLHPNCTLISL
VLVFCCLTENCCSALGRVLLFSPTLRQLDLCVNRLKNYGVLHVTFPLLFPTCQLEELHLS
GCFFSSDICQYIAIVIATNEKLRSLEIGSNKIEDAGMQLLCGGLRHPNCMLVNIGLEECM
LTSACCRSLASVLTTNKTLERLNLLQNHLGNDGVAKLLESLISPDCVLKVVGLPLTGLNT
QTQQLLMTVKERKPSLIFLSETWSLKEGREIGVTPASQPGSIIPNSNLDYMFFKFPRMSA
AMRTSNTASRQPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59045	1.000	1.000	0.000	1033	1.000	1.000	P59045.pdb.gz	NAL11_HUMAN NACHT, LRR and PYD domains-containing protein 11 OS=Homo sapiens OX=9606 GN=NLRP11 PE=2 SV=2
2	AFDB:Q7RTR0	0.655	0.677	4.836E-64	991	0.320	0.334	Q7RTR0.pdb.gz	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
3	AFDB:Q96MN2	0.668	0.690	2.766E-62	994	0.326	0.339	Q96MN2.pdb.gz	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
4	AFDB:Q86W24	0.546	0.523	6.259E-61	1093	0.324	0.306	Q86W24.pdb.gz	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
5	AFDB:Q66X22	0.699	0.717	2.555E-59	1003	0.301	0.310	Q66X22.pdb.gz	NLR9B_MOUSE NACHT, LRR and PYD domains-containing protein 9B OS=Mus musculus OX=10090 GN=Nlrp9b PE=1 SV=1
6	AFDB:Q66X01	0.763	0.782	1.343E-57	1004	0.280	0.288	Q66X01.pdb.gz	NLR9C_MOUSE NACHT, LRR and PYD domains-containing protein 9C OS=Mus musculus OX=10090 GN=Nlrp9c PE=2 SV=1
7	AFDB:Q66X03	0.570	0.611	1.942E-55	949	0.277	0.301	Q66X03.pdb.gz	NLR9A_MOUSE NACHT, LRR and PYD domains-containing protein 9A OS=Mus musculus OX=10090 GN=Nlrp9a PE=1 SV=1
8	AFDB:Q3UWL9	0.589	0.637	2.204E-55	944	0.283	0.309	Q3UWL9.pdb.gz	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
9	AFDB:P59047	0.647	0.567	3.934E-53	1200	0.276	0.237	P59047.pdb.gz	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
10	AFDB:P59046	0.469	0.459	9.685E-52	1061	0.273	0.266	P59046.pdb.gz	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
11	PDB:7pzcA	0.403	0.411	1.537E-40	1010	0.267	0.273	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
12	PDB:7lfhA	0.344	0.421	9.021E-32	806	0.240	0.308	7lfhA.pdb.gz
13	PDB:6npyA	0.342	0.424	3.861E-27	798	0.213	0.276	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
14	PDB:1a4yA	0.363	0.778	1.798E-22	460	0.128	0.287	1a4yA.pdb.gz
15	PDB:4kxfP	0.359	0.411	2.116E-17	866	0.122	0.145	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
16	PDB:3jblA	0.267	0.292	2.812E-15	909	0.130	0.147	3jblA.pdb.gz
17	PDB:6b5bA	0.286	0.256	1.591E-11	1199	0.142	0.123	6b5bA.pdb.gz
18	PDB:5yudA	0.270	0.237	2.241E-8	1238	0.132	0.110	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
19	PDB:3oglB	0.201	0.318	2.374E-7	568	0.065	0.118	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
20	PDB:6o60C	0.243	0.552	1.796E-6	389	0.077	0.206	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59045	0.0	2134	1033	1.000	1.000	NAL11_HUMAN NACHT, LRR and PYD domains-containing protein 11 OS=Homo sapiens OX=9606 GN=NLRP11 PE=2 SV=2
2	Q96MN2	0.0	574	994	0.335	0.348	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
3	Q7RTR0	3.63e-175	540	991	0.329	0.343	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
4	Q86W24	1.36e-165	518	1093	0.324	0.306	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
5	Q3UWL9	7.34e-139	443	944	0.287	0.314	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
6	Q66X22	3.63e-133	429	1003	0.308	0.317	NLR9B_MOUSE NACHT, LRR and PYD domains-containing protein 9B OS=Mus musculus OX=10090 GN=Nlrp9b PE=1 SV=1
7	Q66X05	1.64e-121	397	959	0.269	0.290	NAL4F_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4f PE=1 SV=1
8	P59046	9.42e-117	387	1061	0.285	0.277	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
9	Q66X01	1.64e-116	385	1004	0.287	0.295	NLR9C_MOUSE NACHT, LRR and PYD domains-containing protein 9C OS=Mus musculus OX=10090 GN=Nlrp9c PE=2 SV=1
10	Q66X03	1.53e-113	375	949	0.288	0.314	NLR9A_MOUSE NACHT, LRR and PYD domains-containing protein 9A OS=Mus musculus OX=10090 GN=Nlrp9a PE=1 SV=1
11	F1MT67	2.14e-112	376	1098	0.266	0.250	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
12	Q96P20	8.95e-112	373	1036	0.260	0.260	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
13	Q647I9	1.75e-111	373	1098	0.267	0.251	NALP5_BOVIN NACHT, LRR and PYD domains-containing protein 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=2 SV=1
14	Q8R4B8	3.09e-110	369	1033	0.254	0.254	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
15	P59047	4.74e-108	366	1200	0.247	0.212	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
16	D4A523	1.16e-107	362	1035	0.251	0.250	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
17	E9Q5R7	3.82e-106	358	1054	0.289	0.284	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
18	J3KN39	2.88e-105	355	1059	0.258	0.251	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
19	Q9NX02	3.00e-105	355	1062	0.258	0.250	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
20	Q9R1M5	1.11e-93	325	1163	0.248	0.220	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus OX=10090 GN=Nlrp5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	4.8e+02	12.5	AAA ATPase domain
2	PF12775 AAA_7	3.9e+02	11.9	P-loop containing dynein motor region
3	PF01481 Arteri_nucleo	4.6e+02	12.5	Arterivirus nucleocapsid protein
4	PF13516 LRR_6	0.0014	29.6	Leucine Rich repeat
5	PF05729 NACHT	4.2e-16	70.8	NACHT domain
6	PF17776 NLRC4_HD2	3.7e-07	42.2	NLRC4 helical domain HD2
7	PF17779 NOD2_WH	0.0021	29.6	NOD2 winged helix domain
8	PF02758 PYRIN	9.9e-12	56.2	PAAD/DAPIN/Pyrin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000466285

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219596	0.668	Pyrin
2	9606.ENSP00000428968	0.659	E3 ubiquitin-protein ligase RNF19A
3	9606.ENSP00000260442	0.506	Bcl-2-like protein 10
4	9606.ENSP00000320757	0.504	Modulator of macroautophagy TMEM150B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.999	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.845	multicellular organismal process
GO:0032502	0.809	developmental process
GO:0009987	0.749	cellular process
GO:0065007	0.729	biological regulation
GO:0050789	0.684	regulation of biological process
GO:0048856	0.477	anatomical structure development
GO:0007275	0.450	multicellular organism development
GO:0048518	0.429	positive regulation of biological process
GO:0050794	0.373	regulation of cellular process
GO:0050896	0.346	response to stimulus
GO:0060255	0.345	regulation of macromolecule metabolic process
GO:0001701	0.344	in utero embryonic development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.987	cytosol
GO:0043231	0.956	intracellular membrane-bounded organelle
GO:0005634	0.809	nucleus
GO:0071944	0.540	cell periphery
GO:0032991	0.307	protein-containing complex
GO:0012505	0.307	endomembrane system
GO:0031982	0.304	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]