StarFunc result for job id P59046

User Input

>input (1061 residues)
MLRTAGRDGLCRLSTYLEELEAVELKKFKLYLGTATELGEGKIPWGSMEKAGPLEMAQLL
ITHFGPEEAWRLALSTFERINRKDLWERGQREDLVRDTPPGGPSSLGNQSTCLLEVSLVT
PRKDPQETYRDYVRRKFRLMEDRNARLGECVNLSHRYTRLLLVKEHSNPMQVQQQLLDTG
RGHARTVGHQASPIKIETLFEPDEERPEPPRTVVMQGAAGIGKSMLAHKVMLDWADGKLF
QGRFDYLFYINCREMNQSATECSMQDLIFSCWPEPSAPLQELIRVPERLLFIIDGFDELK
PSFHDPQGPWCLCWEEKRPTELLLNSLIRKKLLPELSLLITTRPTALEKLHRLLEHPRHV
EILGFSEAERKEYFYKYFHNAEQAGQVFNYVRDNEPLFTMCFVPLVCWVVCTCLQQQLEG
GGLLRQTSRTTTAVYMLYLLSLMQPKPGAPRLQPPPNQRGLCSLAADGLWNQKILFEEQD
LRKHGLDGEDVSAFLNMNIFQKDINCERYYSFIHLSFQEFFAAMYYILDEGEGGAGPDQD
VTRLLTEYAFSERSFLALTSRFLFGLLNEETRSHLEKSLCWKVSPHIKMDLLQWIQSKAQ
SDGSTLQQGSLEFFSCLYEIQEEEFIQQALSHFQVIVVSNIASKMEHMVSSFCLKRCRSA
QVLHLYGATYSADGEDRARCSAGAHTLLVQLPERTVLLDAYSEHLAAALCTNPNLIELSL
YRNALGSRGVKLLCQGLRHPNCKLQNLRLKRCRISSSACEDLSAALIANKNLTRMDLSGN
GVGFPGMMLLCEGLRHPQCRLQMIQLRKCQLESGACQEMASVLGTNPHLVELDLTGNALE
DLGLRLLCQGLRHPVCRLRTLWLKICRLTAAACDELASTLSVNQSLRELDLSLNELGDLG
VLLLCEGLRHPTCKLQTLRLGICRLGSAACEGLSVVLQANHNLRELDLSFNDLGDWGLWL
LAEGLQHPACRLQKLWLDSCGLTAKACENLYFTLGINQTLTDLYLTNNALGDTGVRLLCK
RLSHPGCKLRVLWLFGMDLNKMTHSRLAALRVTKPYLDIGC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q5R7	0.771	0.776	0.000	1054	0.725	0.730	E9Q5R7.pdb.gz	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
2	AFDB:P59046	1.000	1.000	0.000	1061	1.000	1.000	P59046.pdb.gz	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
3	AFDB:Q96P20	0.489	0.499	1.957E-88	1036	0.465	0.476	Q96P20.pdb.gz	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
4	AFDB:D4A523	0.540	0.552	3.228E-87	1035	0.473	0.485	D4A523.pdb.gz	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
5	AFDB:Q86W24	0.504	0.493	5.368E-74	1093	0.380	0.369	Q86W24.pdb.gz	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
6	AFDB:P59047	0.511	0.466	1.261E-65	1200	0.325	0.287	P59047.pdb.gz	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
7	AFDB:Q7RTR0	0.575	0.611	7.711E-65	991	0.313	0.335	Q7RTR0.pdb.gz	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
8	AFDB:F1MT67	0.520	0.507	1.749E-64	1098	0.319	0.308	F1MT67.pdb.gz	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
9	AFDB:Q96MN2	0.558	0.590	5.604E-64	994	0.325	0.347	Q96MN2.pdb.gz	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
10	PDB:7pzcA	0.565	0.588	4.409E-62	1010	0.447	0.469	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
11	AFDB:Q9NX02	0.680	0.679	9.083E-62	1062	0.319	0.318	Q9NX02.pdb.gz	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
12	PDB:7lfhA	0.532	0.661	2.064E-48	806	0.402	0.529	7lfhA.pdb.gz
13	PDB:6npyA	0.510	0.638	4.150E-41	798	0.371	0.494	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
14	PDB:1a4yA	0.291	0.581	8.563E-28	460	0.152	0.350	1a4yA.pdb.gz
15	PDB:4kxfP	0.328	0.375	5.709E-22	866	0.150	0.184	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
16	PDB:6b5bA	0.247	0.223	6.554E-15	1199	0.154	0.136	6b5bA.pdb.gz
17	PDB:3jblA	0.280	0.320	3.095E-14	909	0.146	0.171	3jblA.pdb.gz
18	PDB:6o60C	0.259	0.616	6.667E-11	389	0.090	0.244	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
19	PDB:5yudA	0.237	0.213	6.553E-10	1238	0.151	0.129	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
20	PDB:3oglB	0.232	0.379	8.200E-8	568	0.058	0.109	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A523	0.0	882	1035	0.474	0.486	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
2	E9Q5R7	0.0	1545	1054	0.726	0.731	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
3	P59046	0.0	2175	1061	1.000	1.000	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
4	Q86W24	0.0	670	1093	0.385	0.373	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
5	Q8R4B8	0.0	902	1033	0.473	0.486	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
6	Q96P20	0.0	900	1036	0.473	0.485	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
7	Q7RTR0	7.57e-176	542	991	0.326	0.349	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
8	F1MT67	7.21e-164	514	1098	0.331	0.320	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
9	Q647I9	1.33e-163	513	1098	0.330	0.319	NALP5_BOVIN NACHT, LRR and PYD domains-containing protein 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=2 SV=1
10	Q96MN2	9.94e-163	508	994	0.315	0.336	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
11	P59047	9.03e-153	487	1200	0.324	0.287	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
12	J3KN39	3.14e-152	482	1059	0.337	0.338	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
13	Q9NX02	5.19e-152	482	1062	0.332	0.331	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
14	Q9C000	4.93e-146	476	1473	0.308	0.222	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1 OS=Homo sapiens OX=9606 GN=NLRP1 PE=1 SV=1
15	Q3UWL9	2.11e-134	432	944	0.282	0.317	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
16	Q66X03	8.51e-134	430	949	0.286	0.319	NLR9A_MOUSE NACHT, LRR and PYD domains-containing protein 9A OS=Mus musculus OX=10090 GN=Nlrp9a PE=1 SV=1
17	Q9R1M5	5.08e-127	417	1163	0.270	0.246	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus OX=10090 GN=Nlrp5 PE=1 SV=2
18	Q8WX94	8.11e-127	412	980	0.302	0.327	NALP7_HUMAN NACHT, LRR and PYD domains-containing protein 7 OS=Homo sapiens OX=9606 GN=NLRP7 PE=1 SV=1
19	P59044	1.86e-123	401	892	0.282	0.335	NLRP6_HUMAN NACHT, LRR and PYD domains-containing protein 6 OS=Homo sapiens OX=9606 GN=NLRP6 PE=1 SV=2
20	Q66X22	2.90e-123	404	1003	0.283	0.299	NLR9B_MOUSE NACHT, LRR and PYD domains-containing protein 9B OS=Mus musculus OX=10090 GN=Nlrp9b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	2.4e+02	13.5	AAA ATPase domain
2	PF13481 AAA_25	95	14.0	AAA domain
3	PF14484 FISNA	3.3e-10	51.3	Fish-specific NACHT associated domain
4	PF12799 LRR_4	0.014	27.1	Leucine Rich repeats (2 copies)
5	PF13516 LRR_6	1.9e-17	72.8	Leucine Rich repeat
6	PF13855 LRR_8	1.5e+02	13.6	Leucine rich repeat
7	PF05729 NACHT	5.2e-53	190.9	NACHT domain
8	PF00931 NB-ARC	1.5e+02	13.0	NB-ARC domain
9	PF17776 NLRC4_HD2	3.6e-24	97.2	NLRC4 helical domain HD2
10	PF17779 NOD2_WH	8.4e-17	72.5	NOD2 winged helix domain
11	PF02758 PYRIN	3e-21	86.7	PAAD/DAPIN/Pyrin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375653

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000454207	0.968	TNF receptor-associated factor 3
2	9606.ENSP00000358997	0.944	Interleukin-1 receptor-associated kinase 1
3	9606.ENSP00000247470	0.932	Apoptosis-associated speck-like protein containing a CARD
4	9606.ENSP00000335153	0.879	Heat shock protein HSP 90-alpha
5	9606.ENSP00000379457	0.879	FAS-associated factor 1
6	9606.ENSP00000323889	0.839	E3 ubiquitin/ISG15 ligase TRIM25
7	9606.ENSP00000384273	0.827	Transcription factor p65
8	9606.ENSP00000226574	0.823	Nuclear factor NF-kappa-B p105 subunit
9	9606.ENSP00000219596	0.743	Pyrin
10	9606.ENSP00000385090	0.740	NLR family CARD domain-containing protein 4
11	9606.ENSP00000357112	0.681	Interferon-inducible protein AIM2
12	9606.ENSP00000433138	0.654	Caspase-1
13	9606.ENSP00000280357	0.596	Interleukin-18
14	9606.ENSP00000364016	0.580	Proteasome subunit beta type-8
15	9606.ENSP00000452746	0.550	Proline-serine-threonine phosphatase-interacting protein 1
16	9606.ENSP00000428657	0.543	Baculoviral IAP repeat-containing protein 1
17	9606.ENSP00000433623	0.530	TNF receptor-associated factor 6
18	9606.ENSP00000357113	0.529	Gamma-interferon-inducible protein 16
19	9606.ENSP00000263341	0.519	Interleukin-1 beta
20	9606.ENSP00000417658	0.519	Patched domain-containing protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.550	heterocyclic compound binding
GO:0097159	0.529	organic cyclic compound binding
GO:0003676	0.445	nucleic acid binding
GO:0019899	0.383	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0048583	0.987	regulation of response to stimulus
GO:0010468	0.987	regulation of gene expression
GO:0051239	0.985	regulation of multicellular organismal process
GO:0031347	0.984	regulation of defense response
GO:0050896	0.982	response to stimulus
GO:0065009	0.982	regulation of molecular function
GO:0048519	0.982	negative regulation of biological process
GO:0048518	0.982	positive regulation of biological process
GO:0009966	0.982	regulation of signal transduction
GO:0009987	0.980	cellular process
GO:0080090	0.978	regulation of primary metabolic process
GO:0032101	0.978	regulation of response to external stimulus
GO:0051171	0.974	regulation of nitrogen compound metabolic process
GO:0001817	0.974	regulation of cytokine production
GO:1902531	0.965	regulation of intracellular signal transduction
GO:0031323	0.960	regulation of cellular metabolic process
GO:0032652	0.959	regulation of interleukin-1 production
GO:0010604	0.957	positive regulation of macromolecule metabolic process
GO:0051246	0.951	regulation of protein metabolic process
GO:0048523	0.946	negative regulation of cellular process
GO:0048585	0.937	negative regulation of response to stimulus
GO:0050727	0.937	regulation of inflammatory response
GO:1901222	0.916	regulation of NIK/NF-kappaB signaling
GO:0051716	0.914	cellular response to stimulus
GO:1902532	0.910	negative regulation of intracellular signal transduction
GO:0032088	0.905	negative regulation of NF-kappaB transcription factor activity
GO:0032103	0.899	positive regulation of response to external stimulus
GO:0071310	0.897	cellular response to organic substance
GO:0052547	0.895	regulation of peptidase activity
GO:0032102	0.892	negative regulation of response to external stimulus
GO:0052548	0.892	regulation of endopeptidase activity
GO:0031349	0.882	positive regulation of defense response
GO:2000116	0.881	regulation of cysteine-type endopeptidase activity
GO:0043122	0.878	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0032651	0.876	regulation of interleukin-1 beta production
GO:0032732	0.874	positive regulation of interleukin-1 production
GO:0032731	0.864	positive regulation of interleukin-1 beta production
GO:0031348	0.841	negative regulation of defense response
GO:0032675	0.830	regulation of interleukin-6 production
GO:0043085	0.828	positive regulation of catalytic activity
GO:0007154	0.826	cell communication
GO:0051173	0.823	positive regulation of nitrogen compound metabolic process
GO:0006950	0.814	response to stress
GO:0007165	0.810	signal transduction
GO:0009605	0.809	response to external stimulus
GO:0009892	0.809	negative regulation of metabolic process
GO:0010605	0.797	negative regulation of macromolecule metabolic process
GO:0050728	0.797	negative regulation of inflammatory response
GO:0051707	0.796	response to other organism
GO:0002376	0.795	immune system process
GO:0001932	0.786	regulation of protein phosphorylation
GO:0051247	0.785	positive regulation of protein metabolic process
GO:0048522	0.775	positive regulation of cellular process
GO:0001818	0.765	negative regulation of cytokine production
GO:0006952	0.708	defense response
GO:0051172	0.681	negative regulation of nitrogen compound metabolic process
GO:0032692	0.656	negative regulation of interleukin-1 production
GO:0043124	0.643	negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0034097	0.626	response to cytokine
GO:0010647	0.605	positive regulation of cell communication
GO:0009967	0.598	positive regulation of signal transduction
GO:0071345	0.565	cellular response to cytokine stimulus
GO:0002682	0.534	regulation of immune system process
GO:1902533	0.515	positive regulation of intracellular signal transduction
GO:1901700	0.500	response to oxygen-containing compound
GO:1901701	0.441	cellular response to oxygen-containing compound
GO:0009617	0.440	response to bacterium
GO:0098542	0.439	defense response to other organism
GO:0050776	0.438	regulation of immune response
GO:0051091	0.419	positive regulation of DNA-binding transcription factor activity
GO:0002684	0.418	positive regulation of immune system process
GO:0043281	0.413	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0031325	0.391	positive regulation of cellular metabolic process
GO:0002831	0.389	regulation of response to biotic stimulus
GO:0009891	0.384	positive regulation of biosynthetic process
GO:0050729	0.380	positive regulation of inflammatory response
GO:0045088	0.373	regulation of innate immune response
GO:0051092	0.371	positive regulation of NF-kappaB transcription factor activity
GO:0010557	0.363	positive regulation of macromolecule biosynthetic process
GO:0007166	0.338	cell surface receptor signaling pathway
GO:0008152	0.337	metabolic process
GO:0031324	0.336	negative regulation of cellular metabolic process
GO:0045862	0.333	positive regulation of proteolysis
GO:0050778	0.332	positive regulation of immune response
GO:0031328	0.310	positive regulation of cellular biosynthetic process
GO:0071840	0.305	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043229	0.976	intracellular organelle
GO:0043231	0.972	intracellular membrane-bounded organelle
GO:0005654	0.964	nucleoplasm
GO:0032991	0.953	protein-containing complex
GO:0043228	0.669	non-membrane-bounded organelle
GO:0043232	0.647	intracellular non-membrane-bounded organelle
GO:0016020	0.427	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]