StarFunc result for job id P59047

User Input

>input (1200 residues)
MKVAGGLELGAAALLSASPRALVTLSTGPTCSILPKNPLFPQNLSSQPCIKMEGDKSLTF
SSYGLQWCLYELDKEEFQTFKELLKKKSSESTTCSIPQFEIENANVECLALLLHEYYGAS
LAWATSISIFENMNLRTLSEKARDDMKRHSPEDPEATMTDQGPSKEKVPGISQAVQQDSA
TAAETKEQEISQAMEQEGATAAETEEQEISQAMEQEGATAAETEEQGHGGDTWDYKSHVM
TKFAEEEDVRRSFENTAADWPEMQTLAGAFDSDRWGFRPRTVVLHGKSGIGKSALARRIV
LCWAQGGLYQGMFSYVFFLPVREMQRKKESSVTEFISREWPDSQAPVTEIMSRPERLLFI
IDGFDDLGSVLNNDTKLCKDWAEKQPPFTLIRSLLRKVLLPESFLIVTVRDVGTEKLKSE
VVSPRYLLVRGISGEQRIHLLLERGIGEHQKTQGLRAIMNNRELLDQCQVPAVGSLICVA
LQLQDVVGESVAPFNQTLTGLHAAFVFHQLTPRGVVRRCLNLEERVVLKRFCRMAVEGVW
NRKSVFDGDDLMVQGLGESELRALFHMNILLPDSHCEEYYTFFHLSLQDFCAALYYVLEG
LEIEPALCPLYVEKTKRSMELKQAGFHIHSLWMKRFLFGLVSEDVRRPLEVLLGCPVPLG
VKQKLLHWVSLLGQQPNATTPGDTLDAFHCLFETQDKEFVRLALNSFQEVWLPINQNLDL
IASSFCLQHCPYLRKIRVDVKGIFPRDESAEACPVVPLWMRDKTLIEEQWEDFCSMLGTH
PHLRQLDLGSSILTERAMKTLCAKLRHPTCKIQTLMFRNAQITPGVQHLWRIVMANRNLR
SLNLGGTHLKEEDVRMACEALKHPKCLLESLRLDCCGLTHACYLKISQILTTSPSLKSLS
LAGNKVTDQGVMPLSDALRVSQCALQKLILEDCGITATGCQSLASALVSNRSLTHLCLSN
NSLGNEGVNLLCRSMRLPHCSLQRLMLNQCHLDTAGCGFLALALMGNSWLTHLSLSMNPV
EDNGVKLLCEVMREPSCHLQDLELVKCHLTAACCESLSCVISRSRHLKSLDLTDNALGDG
GVAALCEGLKQKNSVLARLGLKACGLTSDCCEALSLALSCNRHLTSLNLVQNNFSPKGMM
KLCSAFACPTSNLQIIGLWKWQYPVQIRKLLEEVQLLKPRVVIDGSWHSFDEDDRYWWKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59047	1.000	1.000	0.000	1200	1.000	1.000	P59047.pdb.gz	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
2	AFDB:F1MT67	0.766	0.836	1.414E-101	1098	0.520	0.568	F1MT67.pdb.gz	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
3	AFDB:Q9R1M5	0.754	0.776	2.110E-92	1163	0.473	0.488	Q9R1M5.pdb.gz	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus OX=10090 GN=Nlrp5 PE=1 SV=2
4	AFDB:Q86W24	0.696	0.757	3.207E-81	1093	0.348	0.382	Q86W24.pdb.gz	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
5	AFDB:Q96MN2	0.594	0.700	5.992E-66	994	0.278	0.335	Q96MN2.pdb.gz	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
6	AFDB:Q7RTR0	0.569	0.669	1.309E-63	991	0.269	0.326	Q7RTR0.pdb.gz	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
7	AFDB:P59046	0.612	0.681	1.619E-63	1061	0.282	0.320	P59046.pdb.gz	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
8	AFDB:Q96P20	0.273	0.304	1.294E-62	1036	0.253	0.293	Q96P20.pdb.gz	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
9	AFDB:D4A523	0.311	0.353	9.499E-62	1035	0.270	0.313	D4A523.pdb.gz	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
10	AFDB:E9Q5R7	0.440	0.485	1.700E-60	1054	0.260	0.296	E9Q5R7.pdb.gz	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
11	PDB:7pzcA	0.358	0.410	7.724E-45	1010	0.263	0.313	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
12	PDB:7lfhA	0.370	0.527	1.469E-34	806	0.225	0.335	7lfhA.pdb.gz
13	PDB:6npyA	0.471	0.655	5.850E-29	798	0.203	0.306	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
14	PDB:1a4yA	0.348	0.866	1.773E-25	460	0.114	0.298	1a4yA.pdb.gz
15	PDB:4kxfP	0.311	0.397	5.248E-20	866	0.142	0.196	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
16	PDB:3jblA	0.250	0.318	4.941E-15	909	0.131	0.173	3jblA.pdb.gz
17	PDB:6b5bA	0.297	0.298	8.172E-11	1199	0.113	0.113	6b5bA.pdb.gz
18	PDB:6o60C	0.252	0.698	1.462E-9	389	0.072	0.221	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
19	PDB:3oglB	0.226	0.416	1.074E-8	568	0.063	0.134	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
20	PDB:5yudA	0.237	0.231	1.712E-8	1238	0.121	0.117	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1MT67	0.0	1181	1098	0.517	0.565	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
2	P59047	0.0	2474	1200	1.000	1.000	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
3	Q647I9	0.0	1180	1098	0.516	0.564	NALP5_BOVIN NACHT, LRR and PYD domains-containing protein 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=2 SV=1
4	Q86W24	0.0	700	1093	0.353	0.388	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
5	Q9R1M5	0.0	1073	1163	0.469	0.484	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus OX=10090 GN=Nlrp5 PE=1 SV=2
6	P59046	6.74e-149	477	1061	0.285	0.322	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
7	Q96MN2	1.29e-145	467	994	0.247	0.299	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
8	Q96P20	6.23e-139	450	1036	0.263	0.304	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
9	D4A523	9.50e-139	449	1035	0.266	0.308	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
10	Q8R4B8	1.56e-137	446	1033	0.263	0.306	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
11	J3KN39	3.59e-136	443	1059	0.276	0.313	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
12	Q9NX02	1.28e-135	442	1062	0.277	0.313	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
13	E9Q5R7	9.95e-135	439	1054	0.271	0.308	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
14	Q7RTR0	2.01e-131	429	991	0.233	0.283	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
15	Q8WX94	1.09e-117	391	980	0.247	0.303	NALP7_HUMAN NACHT, LRR and PYD domains-containing protein 7 OS=Homo sapiens OX=9606 GN=NLRP7 PE=1 SV=1
16	Q66X22	5.88e-111	373	1003	0.229	0.274	NLR9B_MOUSE NACHT, LRR and PYD domains-containing protein 9B OS=Mus musculus OX=10090 GN=Nlrp9b PE=1 SV=1
17	Q3UWL9	4.25e-107	361	944	0.203	0.257	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
18	P59045	3.90e-104	355	1033	0.213	0.248	NAL11_HUMAN NACHT, LRR and PYD domains-containing protein 11 OS=Homo sapiens OX=9606 GN=NLRP11 PE=2 SV=2
19	Q66X01	1.36e-102	350	1004	0.224	0.268	NLR9C_MOUSE NACHT, LRR and PYD domains-containing protein 9C OS=Mus musculus OX=10090 GN=Nlrp9c PE=2 SV=1
20	Q66X03	1.08e-100	343	949	0.216	0.273	NLR9A_MOUSE NACHT, LRR and PYD domains-containing protein 9A OS=Mus musculus OX=10090 GN=Nlrp9a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	1.3	20.9	AAA ATPase domain
2	PF13401 AAA_22	4.1e+02	12.6	AAA domain
3	PF12799 LRR_4	2.1	20.2	Leucine Rich repeats (2 copies)
4	PF13516 LRR_6	4.7e-20	80.9	Leucine Rich repeat
5	PF05729 NACHT	1.7e-41	153.4	NACHT domain
6	PF17776 NLRC4_HD2	1.4e-17	75.9	NLRC4 helical domain HD2
7	PF17779 NOD2_WH	7.5e-13	59.9	NOD2 winged helix domain
8	PF02758 PYRIN	1.9e-17	74.5	PAAD/DAPIN/Pyrin domain
9	PF03193 RsgA_GTPase	3.8e+02	12.4	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375063

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359384	0.889	Oocyte-expressed protein homolog
2	9606.ENSP00000246112	0.841	Transducin-like enhancer protein 6
3	9606.ENSP00000359392	0.795	KHDC3-like protein
4	9606.ENSP00000329803	0.765	Zygote arrest protein 1
5	9606.ENSP00000483125	0.722	Protein-arginine deiminase type-6
6	9606.ENSP00000367942	0.700	Growth/differentiation factor 9
7	9606.ENSP00000381032	0.647	Nucleoplasmin-2
8	9606.ENSP00000291582	0.644	Autoimmune regulator
9	9606.ENSP00000252677	0.600	Bone morphogenetic protein 15
10	9606.ENSP00000333097	0.595	Factor in the germline alpha
11	9606.ENSP00000403644	0.574	Aromatic-L-amino-acid decarboxylase
12	9606.ENSP00000378326	0.562	Zona pellucida sperm-binding protein 3
13	9606.ENSP00000445135	0.556	NACHT, LRR and PYD domains-containing protein 2
14	9606.ENSP00000460971	0.549	Zona pellucida sperm-binding protein 2
15	9606.ENSP00000448059	0.536	Catalyzes the hydroxylation of L-phenylalanine to L-tyrosine.
16	9606.ENSP00000318884	0.521	Formin-2
17	9606.ENSP00000219596	0.513	Pyrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.829	cytoskeletal protein binding
GO:0015631	0.818	tubulin binding
GO:0003676	0.485	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.991	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0009987	0.978	cellular process
GO:0060255	0.967	regulation of macromolecule metabolic process
GO:0010468	0.953	regulation of gene expression
GO:0001817	0.942	regulation of cytokine production
GO:0048518	0.936	positive regulation of biological process
GO:0048519	0.872	negative regulation of biological process
GO:0050896	0.836	response to stimulus
GO:0080090	0.810	regulation of primary metabolic process
GO:0051171	0.802	regulation of nitrogen compound metabolic process
GO:0001819	0.798	positive regulation of cytokine production
GO:0031323	0.760	regulation of cellular metabolic process
GO:0009889	0.728	regulation of biosynthetic process
GO:0019219	0.724	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.697	regulation of RNA metabolic process
GO:0032652	0.686	regulation of interleukin-1 production
GO:0065009	0.600	regulation of molecular function
GO:0032502	0.477	developmental process
GO:0032501	0.474	multicellular organismal process
GO:0071840	0.439	cellular component organization or biogenesis
GO:0051173	0.439	positive regulation of nitrogen compound metabolic process
GO:0010556	0.418	regulation of macromolecule biosynthetic process
GO:0031326	0.418	regulation of cellular biosynthetic process
GO:0048522	0.369	positive regulation of cellular process
GO:0048856	0.342	anatomical structure development
GO:0048583	0.329	regulation of response to stimulus
GO:0006355	0.315	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.997	nucleus
GO:0012505	0.991	endomembrane system
GO:0005829	0.906	cytosol
GO:0032991	0.790	protein-containing complex
GO:0005739	0.569	mitochondrion
GO:0031982	0.543	vesicle
GO:0097708	0.460	intracellular vesicle
GO:0031410	0.452	cytoplasmic vesicle
GO:0005794	0.362	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]