StarFunc result for job id P59095

User Input

>input (220 residues)
MDFKAIAQQTAQEVLGYNRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAK
LSDFLYQTGDRITWDKSLQVYNMVHRIDSDTFICHTITQSFAVGSISPRDFIDLVYIKRY
EGNMNIISSKSVDFPEYPPSSNYIRGYNHPCGFVCSPMEENPAYSKLVMFVQTEMRGKLS
PSIIEKTMPSNLVNFILNAKDGIKAHRTPSRRGFHHNSHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:2r55A	0.888	0.937	2.148E-22	208	0.309	0.327	2r55A.pdb.gz
2	AFDB:Q9NSY2	0.884	0.912	8.104E-22	213	0.314	0.324	Q9NSY2.pdb.gz	STAR5_HUMAN StAR-related lipid transfer protein 5 OS=Homo sapiens OX=9606 GN=STARD5 PE=1 SV=2
3	AFDB:Q99JV5	0.877	0.862	6.547E-21	224	0.259	0.254	Q99JV5.pdb.gz	STAR4_MOUSE StAR-related lipid transfer protein 4 OS=Mus musculus OX=10090 GN=Stard4 PE=1 SV=1
4	PDB:5brlA	0.868	0.908	7.658E-21	210	0.264	0.276	5brlA.pdb.gz
5	PDB:6l1dA	0.860	0.943	6.537E-20	200	0.255	0.280	6l1dA.pdb.gz
6	AFDB:Q96DR4	0.845	0.905	1.207E-19	205	0.255	0.273	Q96DR4.pdb.gz	STAR4_HUMAN StAR-related lipid transfer protein 4 OS=Homo sapiens OX=9606 GN=STARD4 PE=1 SV=1
7	AFDB:P49675	0.888	0.692	8.265E-19	285	0.214	0.165	P49675.pdb.gz	STAR_HUMAN Steroidogenic acute regulatory protein, mitochondrial OS=Homo sapiens OX=9606 GN=STAR PE=1 SV=2
8	AFDB:P51557	0.877	0.687	1.689E-18	284	0.209	0.162	P51557.pdb.gz	STAR_MOUSE Steroidogenic acute regulatory protein, mitochondrial OS=Mus musculus OX=10090 GN=Star PE=1 SV=1
9	AFDB:Q61542	0.838	0.426	3.267E-18	446	0.186	0.092	Q61542.pdb.gz	STAR3_MOUSE StAR-related lipid transfer protein 3 OS=Mus musculus OX=10090 GN=Stard3 PE=1 SV=1
10	AFDB:Q9DG10	0.875	0.681	3.113E-17	285	0.182	0.140	Q9DG10.pdb.gz	STAR_DANRE Steroidogenic acute regulatory protein, mitochondrial OS=Danio rerio OX=7955 GN=star PE=2 SV=1
11	AFDB:J3QLM1	0.731	0.348	3.521E-15	475	0.177	0.082	J3QLM1.pdb.gz	J3QLM1_HUMAN StAR related lipid transfer domain containing 3 OS=Homo sapiens OX=9606 GN=STARD3 PE=1 SV=1
12	AFDB:F4JSE7	0.721	0.239	7.652E-14	718	0.145	0.045	F4JSE7.pdb.gz	EDR2_ARATH Protein ENHANCED DISEASE RESISTANCE 2 OS=Arabidopsis thaliana OX=3702 GN=EDR2 PE=2 SV=1
13	AFDB:Q99NB7	0.759	0.320	1.844E-13	556	0.191	0.076	Q99NB7.pdb.gz	ACO12_RAT Acetyl-coenzyme A thioesterase OS=Rattus norvegicus OX=10116 GN=Acot12 PE=1 SV=1
14	PDB:6serA	0.770	0.697	1.743E-12	245	0.155	0.139	6serA.pdb.gz
15	PDB:1ln1A	0.688	0.738	7.740E-11	203	0.141	0.153	1ln1A.pdb.gz	Structure of human phosphatidylcholine transfer protein in complex with its ligand.
16	PDB:3w9rA	0.481	0.591	2.554E-4	171	0.059	0.076	3w9rA.pdb.gz	Mechanism of high-affinity abscisic acid binding to PYL9/RCAR1.
17	PDB:2qimA	0.397	0.510	3.183E-4	157	0.118	0.166	2qimA.pdb.gz	Lupinus luteus pathogenesis-related protein as a reservoir for cytokinin.
18	PDB:3nefA	0.469	0.546	3.183E-4	182	0.073	0.088	3nefA.pdb.gz	Functional mechanism of the ABA agonist pyrabactin
19	PDB:1ifvA	0.432	0.564	3.753E-4	155	0.105	0.148	1ifvA.pdb.gz
20	PDB:3ojiB	0.492	0.568	5.827E-4	185	0.082	0.097	3ojiB.pdb.gz	Complex Structures of the Abscisic Acid Receptor PYL3/RCAR13 Reveal a Unique Regulatory Mechanism

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NSY2	8.24e-43	145	213	0.309	0.319	STAR5_HUMAN StAR-related lipid transfer protein 5 OS=Homo sapiens OX=9606 GN=STARD5 PE=1 SV=2
2	Q99JV5	3.18e-31	115	224	0.250	0.246	STAR4_MOUSE StAR-related lipid transfer protein 4 OS=Mus musculus OX=10090 GN=Stard4 PE=1 SV=1
3	Q96DR4	2.51e-30	113	205	0.264	0.283	STAR4_HUMAN StAR-related lipid transfer protein 4 OS=Homo sapiens OX=9606 GN=STARD4 PE=1 SV=1
4	P49675	3.17e-17	80.1	285	0.218	0.168	STAR_HUMAN Steroidogenic acute regulatory protein, mitochondrial OS=Homo sapiens OX=9606 GN=STAR PE=1 SV=2
5	P51557	2.20e-15	75.1	284	0.218	0.169	STAR_MOUSE Steroidogenic acute regulatory protein, mitochondrial OS=Mus musculus OX=10090 GN=Star PE=1 SV=1
6	Q14849	2.75e-15	75.9	445	0.182	0.090	STAR3_HUMAN StAR-related lipid transfer protein 3 OS=Homo sapiens OX=9606 GN=STARD3 PE=1 SV=2
7	P97826	1.02e-14	73.2	284	0.214	0.165	STAR_RAT Steroidogenic acute regulatory protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Star PE=1 SV=1
8	Q61542	1.85e-14	73.6	446	0.173	0.085	STAR3_MOUSE StAR-related lipid transfer protein 3 OS=Mus musculus OX=10090 GN=Stard3 PE=1 SV=1
9	Q9DG10	3.27e-14	72.0	285	0.186	0.144	STAR_DANRE Steroidogenic acute regulatory protein, mitochondrial OS=Danio rerio OX=7955 GN=star PE=2 SV=1
10	J3QLM1	1.14e-11	65.5	475	0.159	0.074	J3QLM1_HUMAN StAR related lipid transfer domain containing 3 OS=Homo sapiens OX=9606 GN=STARD3 PE=1 SV=1
11	Q8VHQ9	3.60e-05	46.2	594	0.127	0.047	ACO11_MOUSE Acyl-coenzyme A thioesterase 11 OS=Mus musculus OX=10090 GN=Acot11 PE=1 SV=1
12	Q99NB7	8.95e-05	45.1	556	0.268	0.106	ACO12_RAT Acetyl-coenzyme A thioesterase OS=Rattus norvegicus OX=10116 GN=Acot12 PE=1 SV=1
13	O04291	5.78e-04	42.7	852	0.155	0.040	ATB14_ARATH Homeobox-leucine zipper protein ATHB-14 OS=Arabidopsis thaliana OX=3702 GN=ATHB-14 PE=1 SV=1
14	Q9NQZ5	6.34e-04	42.4	370	0.177	0.105	STAR7_HUMAN StAR-related lipid transfer protein 7, mitochondrial OS=Homo sapiens OX=9606 GN=STARD7 PE=1 SV=2
15	Q8WXI4	0.001	42.0	607	0.123	0.044	ACO11_HUMAN Acyl-coenzyme A thioesterase 11 OS=Homo sapiens OX=9606 GN=ACOT11 PE=1 SV=1
16	Q9DBK0	0.002	41.2	556	0.241	0.095	ACO12_MOUSE Acetyl-coenzyme A thioesterase OS=Mus musculus OX=10090 GN=Acot12 PE=1 SV=1
17	Q8WYK0	0.011	38.9	555	0.177	0.070	ACO12_HUMAN Acetyl-coenzyme A thioesterase OS=Homo sapiens OX=9606 GN=ACOT12 PE=1 SV=1
18	Q39123	0.015	38.5	833	0.141	0.037	ATHB8_ARATH Homeobox-leucine zipper protein ATHB-8 OS=Arabidopsis thaliana OX=3702 GN=ATHB-8 PE=1 SV=1
19	Q8R1R3	0.054	36.6	373	0.159	0.094	STAR7_MOUSE StAR-related lipid transfer protein 7, mitochondrial OS=Mus musculus OX=10090 GN=Stard7 PE=1 SV=2
20	F5H1Z6	0.096	35.4	252	0.182	0.159	F5H1Z6_HUMAN StAR related lipid transfer domain containing 10 (Fragment) OS=Homo sapiens OX=9606 GN=STARD10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01852 START	1e-23	95.4	START domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000462349

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000276449	0.921	Steroidogenic acute regulatory protein, mitochondrial
2	9606.ENSP00000268896	0.812	Phosphatidylcholine transfer protein
3	9606.ENSP00000363727	0.805	StAR-related lipid transfer protein 8
4	9606.ENSP00000269466	0.736	Zinc phosphodiesterase ELAC protein 1
5	9606.ENSP00000290607	0.676	StAR-related lipid transfer protein 9
6	9606.ENSP00000299721	0.673	Complexin-4
7	9606.ENSP00000338785	0.664	StAR-related lipid transfer protein 13
8	9606.ENSP00000303246	0.648	Acyl-coenzyme A thioesterase 12
9	9606.ENSP00000355374	0.628	Oxidative stress-induced growth inhibitor 1
10	9606.ENSP00000360366	0.624	Acyl-coenzyme A thioesterase 11
11	9606.ENSP00000337446	0.612	StAR-related lipid transfer protein 3
12	9606.ENSP00000385610	0.598	RNA-binding E3 ubiquitin-protein ligase MEX3C
13	9606.ENSP00000466690	0.579	Coiled-coil domain-containing protein 68
14	9606.ENSP00000477707	0.573	Oxysterols receptor LXR-alpha
15	9606.ENSP00000262094	0.557	Ras-related protein Rab-27B
16	9606.ENSP00000377233	0.553	Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1
17	9606.ENSP00000335247	0.543	START domain-containing protein 10
18	9606.ENSP00000348069	0.539	Sterol regulatory element-binding protein 1
19	9606.ENSP00000383234	0.531	Mitogen-activated protein kinase 4
20	9606.ENSP00000369862	0.511	Collagen type IV alpha-3-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0097159	1.000	organic cyclic compound binding
GO:0008289	1.000	lipid binding
GO:0005515	0.999	protein binding
GO:0043178	0.999	alcohol binding
GO:0032934	0.994	sterol binding
GO:0005319	0.987	lipid transporter activity
GO:0015485	0.982	cholesterol binding
GO:0015248	0.934	sterol transporter activity
GO:0120015	0.910	sterol transfer activity
GO:0120020	0.829	cholesterol transfer activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.936	cellular process
GO:0065007	0.925	biological regulation
GO:0050789	0.858	regulation of biological process
GO:0051179	0.630	localization
GO:0006810	0.619	transport
GO:0050794	0.579	regulation of cellular process
GO:0033036	0.541	macromolecule localization
GO:0010876	0.526	lipid localization
GO:0019222	0.506	regulation of metabolic process
GO:0048518	0.491	positive regulation of biological process
GO:0006869	0.491	lipid transport
GO:0071704	0.445	organic substance metabolic process
GO:0044238	0.440	primary metabolic process
GO:0015918	0.377	sterol transport
GO:0048522	0.318	positive regulation of cellular process
GO:0009893	0.307	positive regulation of metabolic process
GO:0019216	0.305	regulation of lipid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.958	cytosol
GO:0070013	0.953	intracellular organelle lumen
GO:0043227	0.940	membrane-bounded organelle
GO:0043231	0.934	intracellular membrane-bounded organelle
GO:0031982	0.438	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:39747	0.934	cholesterol(in) = cholesterol(out)

[back to server]