StarFunc result for job id P59103

User Input

>input (153 residues)
MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEG
WKRRHEDGYLEMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASK
DRRQPLERMWTCNYNQQKDQSCNHKEITSTKAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59103	1.000	1.000	8.874E-23	153	1.000	1.000	P59103.pdb.gz	DAOA_HUMAN D-amino acid oxidase activator OS=Homo sapiens OX=9606 GN=DAOA PE=1 SV=2
2	PDB:7q83D	0.318	0.314	1.636	156	0.163	0.160	7q83D.pdb.gz
3	PDB:5mkkA	0.239	0.078	3.643	593	0.124	0.032	5mkkA.pdb.gz
4	PDB:5dseA	0.194	0.069	4.661	537	0.078	0.022	5dseA.pdb.gz
5	PDB:7ohrI	0.181	0.075	5.964	409	0.137	0.051	7ohrI.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
6	PDB:6sueA	0.236	0.027	6.746	2292	0.118	0.008	6sueA.pdb.gz
7	PDB:3gz1A	0.126	0.133	9.179	144	0.085	0.090	3gz1A.pdb.gz	IpaB-IpgC interaction defines binding motif for type III secretion translocator
8	PDB:6v9iC	0.139	0.045	9.762	730	0.085	0.018	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59103	2.93e-114	321	153	1.000	1.000	DAOA_HUMAN D-amino acid oxidase activator OS=Homo sapiens OX=9606 GN=DAOA PE=1 SV=2
2	Q9V4A7	6.0	29.6	2051	0.105	0.008	PLXB_DROME Plexin-B OS=Drosophila melanogaster OX=7227 GN=PlexB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15199 DAOA	2.6e-56	199.3	D-amino acid oxidase activator

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483757

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228476	0.964	D-amino-acid oxidase
2	9606.ENSP00000341680	0.803	Dysbindin
3	9606.ENSP00000355593	0.751	Disrupted in schizophrenia 1 protein
4	9606.ENSP00000384620	0.708	Pro-neuregulin-1, membrane-bound isoform
5	9606.ENSP00000354511	0.681	Catechol O-methyltransferase
6	9606.ENSP00000397181	0.653	Regulator of G-protein signaling 4
7	9606.ENSP00000355316	0.566	Metabotropic glutamate receptor 3
8	9606.ENSP00000271234	0.525	Formin-binding protein 1-like
9	9606.ENSP00000303252	0.520	Zinc finger protein 804A
10	9606.ENSP00000176183	0.519	Dopamine receptor D4
11	9606.ENSP00000339435	0.519	Serine racemase
12	9606.ENSP00000275198	0.518	Trace amine-associated receptor 6
13	9606.ENSP00000380878	0.518	Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0008047	1.000	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.991	biological regulation
GO:0050790	0.915	regulation of catalytic activity
GO:0044092	0.840	negative regulation of molecular function
GO:0051341	0.810	regulation of oxidoreductase activity
GO:0043086	0.741	negative regulation of catalytic activity
GO:0044093	0.696	positive regulation of molecular function
GO:0043085	0.669	positive regulation of catalytic activity
GO:0051354	0.580	negative regulation of oxidoreductase activity
GO:0009987	0.474	cellular process
GO:0050896	0.339	response to stimulus
GO:0050789	0.308	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0005794	0.999	Golgi apparatus
GO:0048471	0.998	perinuclear region of cytoplasm
GO:0005634	0.705	nucleus
GO:0071944	0.517	cell periphery
GO:0005886	0.511	plasma membrane
GO:0070013	0.424	intracellular organelle lumen
GO:0031981	0.320	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]