StarFunc result for job id P59510

User Input

>input (1910 residues)
MWVAKWLTGLLYHLSLFITRSWEVDFHPRQEALVRTLTSYEVVIPERVNEFGEVFPQSHH
FSRQKRSSEALEPMPFRTHYRFTAYGQLFQLNLTADASFLAAGYTEVHLGTPERGAWESD
AGPSDLRHCFYRGQVNSQEDYKAVVSLCGGLTGTFKGQNGEYFLEPIMKADGNEYEDGHN
KPHLIYRQDLNNSFLQTLKYCSVSESQIKETSLPFHTYSNMNEDLNVMKERVLGHTSKNV
PLKDERRHSRKKRLISYPRYIEIMVTADAKVVSAHGSNLQNYILTLMSIVATIYKDPSIG
NLIHIVVVKLVMIHREEEGPVINFDGATTLKNFCSWQQTQNDLDDVHPSHHDTAVLITRE
DICSSKEKCNMLGLSYLGTICDPLQSCFINEEKGLISAFTIAHELGHTLGVQHDDNPRCK
EMKVTKYHVMAPALSFHMSPWSWSNCSRKYVTEFLDTGYGECLLDKPDEEIYNLPSELPG
SRYDGNKQCELAFGPGSQMCPHINICMHLWCTSTEKLHKGCFTQHVPPADGTDCGPGMHC
RHGLCVNKETETRPVNGEWGPWEPYSSCSRTCGGGIESATRRCNRPEPRNGGNYCVGRRM
KFRSCNTDSCPKGTQDFREKQCSDFNGKHLDISGIPSNVRWLPRYSGIGTKDRCKLYCQV
AGTNYFYLLKDMVEDGTPCGTETHDICVQGQCMAAGCDHVLNSSAKIDKCGVCGGDNSSC
KTITGVFNSSHYGYNVVVKIPAGATNVDIRQYSYSGQPDDSYLALSDAEGNFLFNGNFLL
STSKKEINVQGTRTVIEYSGSNNAVERINSTNRQEKEILIEVLCVGNLYNPDVHYSFNIP
LEERSDMFTWDPYGPWEGCTKMCQGLQRRNITCIHKSDHSVVSDKECDHLPLPSFVTQSC
NTDCELRWHVIGKSECSSQCGQGYRTLDIHCMKYSIHEGQTVQVDDHYCGDQLKPPTQEL
CHGNCVFTRWHYSEWSQCSRSCGGGERSRESYCMNNFGHRLADNECQELSRVTRENCNEF
SCPSWAASEWSECLVTCGKGTKQRQVWCQLNVDHLSDGFCNSSTKPESLSPCELHTCASW
QVGPWGPCTTTCGHGYQMRDVKCVNELASAVLEDTECHEASRPSDRQSCVLTPCSFISKL
ETALLPTVLIKKMAQWRHGSWTPCSVSCGRGTQARYVSCRDALDRIADESYCAHLPRPAE
IWDCFTPCGEWQAGDWSPCSASCGHGKTTRQVLCMNYHQPIDENYCDPEVRPLMEQECSL
AACPPAHSHFPSSPVQPSYYLSTNLPLTQKLEDNENQVVHPSVRGNQWRTGPWGSCSSSC
SGGLQHRAVVCQDENGQSASYCDAASKPPELQQCGPGPCPQWNYGNWGECSQTCGGGIKS
RLVICQFPNGQILEDHNCEIVNKPPSVIQCHMHACPADVSWHQEPWTSCSASCGKGRKYR
EVFCIDQFQRKLEDTNCSQVQKPPTHKACRSVRCPSWKANSWNECSVTCGSGVQQRDVYC
RLKGVGQVVEEMCDQSTRPCSQRRCWSQDCVQHKGMERGRLNCSTSCERKDSHQRMECTD
NQIRQVNEIVYNSSTISLTSKNCRNPPCNYIVVTADSSQCANNCGFSYRQRITYCTEIPS
TKKHKLHRLRPIVYQECPVVPSSQVYQCINSCLHLATWKVGKWSKCSVTCGIGIMKRQVK
CITKHGLSSDLCLNHLKPGAQKKCYANDCKSFTTCKEIQVKNHIRKDGDYYLNIKGRIIK
IYCADMYLENPKEYLTLVQGEENFSEVYGFRLKNPYQCPFNGSRREDCECDNGHLAAGYT
VFSKIRIDLTSMQIKTTDLLFSKTIFGNAVPFATAGDCYSAFRCPQGQFSINLSGTGMKI
SSTAKWLTQGSYTSVSIRRSEDGTRFFGKCGGYCGKCLPHMTTGLPIQVI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PUN6	0.506	0.501	0.000	1931	0.505	0.500	E9PUN6.pdb.gz	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
2	AFDB:P59510	1.000	1.000	0.000	1910	1.000	1.000	P59510.pdb.gz	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
3	AFDB:P59511	0.464	0.465	0.000	1906	0.704	0.705	P59511.pdb.gz	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
4	AFDB:Q19791	0.305	0.272	0.000	2150	0.349	0.310	Q19791.pdb.gz	GON1_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs gon-1 OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=3
5	AFDB:Q8SXB0	0.295	0.329	0.000	1688	0.238	0.270	Q8SXB0.pdb.gz	Q8SXB0_DROME ADAM metallopeptidase with thrombospondin type 1 motif A, isoform B OS=Drosophila melanogaster OX=7227 GN=AdamTS-A PE=2 SV=1
6	AFDB:Q9P2N4	0.475	0.470	0.000	1935	0.508	0.501	Q9P2N4.pdb.gz	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
7	AFDB:D3Z1A5	0.361	0.595	1.984E-98	1117	0.193	0.329	D3Z1A5.pdb.gz	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
8	AFDB:Q8TE60	0.285	0.425	5.166E-96	1221	0.191	0.298	Q8TE60.pdb.gz	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
9	AFDB:P97857	0.324	0.598	2.839E-95	968	0.195	0.384	P97857.pdb.gz	ATS1_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Mus musculus OX=10090 GN=Adamts1 PE=1 SV=4
10	AFDB:Q4VC17	0.304	0.449	2.329E-94	1219	0.192	0.301	Q4VC17.pdb.gz	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
11	PDB:1w0rA	0.035	0.106	1.259E-12	442	0.052	0.224	1w0rA.pdb.gz
12	PDB:4q1lA	0.097	0.813	9.367E-11	202	0.031	0.292	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
13	PDB:7vonA	0.034	0.044	6.058E-5	1399	0.053	0.073	7vonA.pdb.gz
14	PDB:7ufgA	0.073	0.114	6.370E-5	1151	0.079	0.130	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
15	PDB:5a42A	0.036	0.041	1.570E-4	1597	0.041	0.049	5a42A.pdb.gz
16	PDB:7q1yA	0.033	0.043	2.344E-4	1374	0.048	0.067	7q1yA.pdb.gz
17	PDB:2q7zA	0.033	0.033	3.680E-4	1931	0.096	0.095	2q7zA.pdb.gz
18	PDB:4aq1A	0.029	0.058	3.869E-4	721	0.035	0.093	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
19	PDB:7nycC	0.035	0.071	6.074E-4	809	0.045	0.105	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:7q5zA	0.046	0.057	7.059E-4	1344	0.048	0.068	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PUN6	0.0	1942	1931	0.506	0.500	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
2	E9PYV8	0.0	1402	1350	0.362	0.513	E9PYV8_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
3	F1SFS3	0.0	1915	2000	0.496	0.474	F1SFS3_PIG ADAM metallopeptidase with thrombospondin type 1 motif 9 OS=Sus scrofa OX=9823 GN=ADAMTS9 PE=4 SV=5
4	H0Y859	0.0	939	991	0.247	0.475	H0Y859_HUMAN ADAM metallopeptidase with thrombospondin type 1 motif 9 (Fragment) OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=1
5	H2L2A7	0.0	887	2165	0.301	0.265	H2L2A7_CAEEL Peptidase M12B domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=1
6	P59384	0.0	678	950	0.201	0.403	ATS15_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 15 OS=Mus musculus OX=10090 GN=Adamts15 PE=1 SV=2
7	P59510	0.0	3989	1910	1.000	1.000	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
8	P59511	0.0	2881	1906	0.705	0.706	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
9	P97857	0.0	632	968	0.184	0.363	ATS1_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Mus musculus OX=10090 GN=Adamts1 PE=1 SV=4
10	Q19791	0.0	898	2150	0.301	0.267	GON1_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs gon-1 OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=3
11	Q8CDB8	0.0	570	701	0.160	0.435	Q8CDB8_MOUSE GON domain-containing protein OS=Mus musculus OX=10090 GN=Adamts9 PE=2 SV=1
12	Q9P2N4	0.0	1973	1935	0.506	0.499	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
13	Q9UHI8	0.0	613	967	0.181	0.358	ATS1_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Homo sapiens OX=9606 GN=ADAMTS1 PE=1 SV=4
14	Q9UKP5	0.0	584	1117	0.195	0.334	ATS6_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 6 OS=Homo sapiens OX=9606 GN=ADAMTS6 PE=2 SV=2
15	Q9UP79	0.0	593	889	0.172	0.370	ATS8_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 8 OS=Homo sapiens OX=9606 GN=ADAMTS8 PE=2 SV=2
16	Q9WUQ1	0.0	634	967	0.186	0.368	ATS1_RAT A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Rattus norvegicus OX=10116 GN=Adamts1 PE=2 SV=1
17	D3Z1A5	1.67e-180	579	1117	0.196	0.335	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
18	Q9H324	3.22e-173	559	1103	0.195	0.338	ATS10_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2
19	Q7KSH7	1.26e-169	561	1537	0.209	0.260	Q7KSH7_DROME ADAM metallopeptidase with thrombospondin type 1 motif A, isoform E OS=Drosophila melanogaster OX=7227 GN=AdamTS-A PE=4 SV=1
20	A0A0B4KHK4	3.61e-169	561	1585	0.209	0.252	A0A0B4KHK4_DROME ADAM metallopeptidase with thrombospondin type 1 motif A, isoform C OS=Drosophila melanogaster OX=7227 GN=AdamTS-A PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	1.2e-14	65.9	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	0.00029	32.2	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	3.3e-21	87.1	ADAM-TS Spacer 1
4	PF08685 GON	1.7e-75	264.7	GON domain
5	PF00413 Peptidase_M10	4.1e+02	12.2	Matrixin
6	PF01562 Pep_M12B_propep	4.4e-31	119.5	Reprolysin family propeptide
7	PF01421 Reprolysin	1.4e-21	88.9	Reprolysin (M12B) family zinc metalloprotease
8	PF13574 Reprolysin_2	0.00016	33.2	Metallo-peptidase family M12B Reprolysin-like
9	PF13582 Reprolysin_3	6.3e-06	38.1	Metallo-peptidase family M12B Reprolysin-like
10	PF13583 Reprolysin_4	2.4	19.3	Metallo-peptidase family M12B Reprolysin-like
11	PF13688 Reprolysin_5	2.7e-10	52.2	Metallo-peptidase family M12
12	PF19030 TSP1_ADAMTS	8.1e-123	412.0	Thrombospondin type 1 domain
13	PF19035 TSP1_CCN	4.8e-11	54.1	CCN3 Nov like TSP1 domain
14	PF19028 TSP1_spondin	6.8e-13	60.0	Spondin-like TSP1 domain
15	PF00090 TSP_1	4.5e-42	153.3	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374071

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343002	0.964	Beta-1,3-glucosyltransferase
2	9606.ENSP00000274487	0.928	ADAM metallopeptidase with thrombospondin type 1 motif 19
3	9606.ENSP00000346478	0.927	ADAMTS-like protein 2
4	9606.ENSP00000339613	0.926	GDP-fucose protein O-fucosyltransferase 2
5	9606.ENSP00000358035	0.925	ADAMTS-like protein 4
6	9606.ENSP00000260356	0.924	Thrombospondin-1
7	9606.ENSP00000369921	0.923	ADAMTS-like protein 1
8	9606.ENSP00000327608	0.922	ADAMTS-like protein 5
9	9606.ENSP00000360997	0.922	A disintegrin and metalloproteinase with thrombospondin motifs 13
10	9606.ENSP00000286744	0.921	ADAMTS-like protein 3
11	9606.ENSP00000362304	0.921	A disintegrin and metalloproteinase with thrombospondin motifs 14
12	9606.ENSP00000422554	0.921	A disintegrin and metalloproteinase with thrombospondin motifs 12
13	9606.ENSP00000373472	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 7
14	9606.ENSP00000251582	0.918	A disintegrin and metalloproteinase with thrombospondin motifs 2
15	9606.ENSP00000286657	0.918	A disintegrin and metalloproteinase with thrombospondin motifs 3
16	9606.ENSP00000268070	0.917	ADAM metallopeptidase with thrombospondin type 1 motif 17
17	9606.ENSP00000274181	0.916	ADAM metallopeptidase with thrombospondin type 1 motif 16
18	9606.ENSP00000347484	0.916	Thrombospondin type-1 domain-containing protein 4
19	9606.ENSP00000282849	0.915	ADAM metallopeptidase with thrombospondin type 1 motif 18
20	9606.ENSP00000270328	0.912	A disintegrin and metalloproteinase with thrombospondin motifs 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008237	0.999	metallopeptidase activity
GO:0004175	0.994	endopeptidase activity
GO:0005488	0.982	binding
GO:0005515	0.931	protein binding
GO:0004222	0.892	metalloendopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.961	multicellular organismal process
GO:0009987	0.958	cellular process
GO:0048856	0.940	anatomical structure development
GO:0007275	0.770	multicellular organism development
GO:0043170	0.724	macromolecule metabolic process
GO:0044238	0.717	primary metabolic process
GO:0048731	0.708	system development
GO:0006807	0.706	nitrogen compound metabolic process
GO:1901564	0.676	organonitrogen compound metabolic process
GO:0065007	0.663	biological regulation
GO:0050789	0.645	regulation of biological process
GO:0019538	0.600	protein metabolic process
GO:0050794	0.544	regulation of cellular process
GO:0048513	0.498	animal organ development
GO:0071840	0.435	cellular component organization or biogenesis
GO:0016043	0.408	cellular component organization
GO:0050896	0.311	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031012	0.995	extracellular matrix
GO:0062023	0.974	collagen-containing extracellular matrix
GO:0005576	0.953	extracellular region
GO:0043226	0.797	organelle
GO:0005622	0.721	intracellular anatomical structure
GO:0043229	0.697	intracellular organelle
GO:0043227	0.583	membrane-bounded organelle
GO:0012505	0.308	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.999	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.892	Metalloendopeptidases.

[back to server]