StarFunc result for job id P59539

User Input

>input (299 residues)
MITFLPIIFSILVVVTFVIGNFANGFIALVNSTEWVKRQKISFADQIVTALAVSRVGLLW
VLLLNWYSTVLNPAFCSVELRTTAYNIWAVTGHFSNWPATSLSIFYLLKIANFSNLIFLR
LKRRVKSVILVVLLGPLLFLACHLFVVNMNQIVWTKEYEGNMTWKIKLRRAMYLSDTTVT
MLANLVPFTVTLISFLLLVCSLCKHLKKMQLHGKGSQDPSTKVHIKVLQTVISFFLLRAI
YFVSVIISVWSFKNLENKPVFMFCQAIGFSCSSAHPFILIWGNKKLKQTYLSVLWQMRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59539	1.000	1.000	3.530E-36	299	1.000	1.000	P59539.pdb.gz	T2R45_HUMAN Taste receptor type 2 member 45 OS=Homo sapiens OX=9606 GN=TAS2R45 PE=2 SV=1
2	AFDB:P59537	0.990	0.958	6.272E-32	309	0.860	0.832	P59537.pdb.gz	T2R43_HUMAN Taste receptor type 2 member 43 OS=Homo sapiens OX=9606 GN=TAS2R43 PE=2 SV=2
3	AFDB:P59540	0.970	0.939	2.210E-30	309	0.853	0.825	P59540.pdb.gz	T2R46_HUMAN Taste receptor type 2 member 46 OS=Homo sapiens OX=9606 GN=TAS2R46 PE=1 SV=2
4	AFDB:P59538	0.975	0.944	3.861E-30	309	0.839	0.812	P59538.pdb.gz	T2R31_HUMAN Taste receptor type 2 member 31 OS=Homo sapiens OX=9606 GN=TAS2R31 PE=2 SV=2
5	AFDB:P59541	0.964	0.904	6.020E-29	319	0.809	0.759	P59541.pdb.gz	T2R30_HUMAN Taste receptor type 2 member 30 OS=Homo sapiens OX=9606 GN=TAS2R30 PE=2 SV=3
6	AFDB:P59543	0.964	0.933	1.363E-25	309	0.679	0.657	P59543.pdb.gz	T2R20_HUMAN Taste receptor type 2 member 20 OS=Homo sapiens OX=9606 GN=TAS2R20 PE=2 SV=2
7	AFDB:P59542	0.962	0.962	3.358E-25	299	0.652	0.652	P59542.pdb.gz	T2R19_HUMAN Taste receptor type 2 member 19 OS=Homo sapiens OX=9606 GN=TAS2R19 PE=1 SV=1
8	AFDB:P59544	0.936	0.936	4.344E-25	299	0.682	0.682	P59544.pdb.gz	T2R50_HUMAN Taste receptor type 2 member 50 OS=Homo sapiens OX=9606 GN=TAS2R50 PE=2 SV=2
9	PDB:7xp4R	0.805	0.805	7.639E-25	299	0.843	0.843	7xp4R.pdb.gz
10	AFDB:Q9NYV9	0.872	0.861	8.427E-18	303	0.428	0.422	Q9NYV9.pdb.gz	T2R13_HUMAN Taste receptor type 2 member 13 OS=Homo sapiens OX=9606 GN=TAS2R13 PE=1 SV=1
11	AFDB:Q9JKT7	0.890	0.874	1.371E-16	305	0.388	0.380	Q9JKT7.pdb.gz	T2R13_RAT Taste receptor type 2 member 13 OS=Rattus norvegicus OX=10116 GN=Tas2r13 PE=1 SV=1
12	PDB:6iblA	0.624	0.492	3.099E-5	397	0.151	0.113	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
13	PDB:7sk8A	0.584	0.572	3.679E-5	306	0.167	0.163	7sk8A.pdb.gz	Structures of atypical chemokine receptor 3 reveal the basis for its promiscuity and signaling bias.
14	PDB:7wvuR	0.651	0.653	4.759E-5	298	0.164	0.164	7wvuR.pdb.gz	Structural basis of FPR2 in recognition of A beta 42 and neuroprotection by humanin.
15	PDB:6osaR	0.703	0.660	7.003E-5	321	0.130	0.121	6osaR.pdb.gz	Conformational transitions of a neurotensin receptor 1-Gi1complex.
16	PDB:6lw5A	0.643	0.471	9.060E-5	427	0.154	0.108	6lw5A.pdb.gz	Structural basis of ligand binding modes at the human formyl peptide receptor 2.
17	PDB:7ezmD	0.699	0.689	9.872E-5	304	0.167	0.164	7ezmD.pdb.gz	Ligand recognition and G-protein coupling selectivity of cholecystokinin A receptor
18	PDB:7wq3R	0.673	0.694	1.030E-4	289	0.130	0.135	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
19	PDB:7w55R	0.689	0.681	1.277E-4	303	0.177	0.175	7w55R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
20	PDB:7jvrR	0.632	0.693	1.333E-4	269	0.164	0.182	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59537	0.0	517	309	0.860	0.832	T2R43_HUMAN Taste receptor type 2 member 43 OS=Homo sapiens OX=9606 GN=TAS2R43 PE=2 SV=2
2	P59539	0.0	601	299	1.000	1.000	T2R45_HUMAN Taste receptor type 2 member 45 OS=Homo sapiens OX=9606 GN=TAS2R45 PE=2 SV=1
3	P59540	0.0	522	309	0.853	0.825	T2R46_HUMAN Taste receptor type 2 member 46 OS=Homo sapiens OX=9606 GN=TAS2R46 PE=1 SV=2
4	P59541	2.32e-174	486	319	0.809	0.759	T2R30_HUMAN Taste receptor type 2 member 30 OS=Homo sapiens OX=9606 GN=TAS2R30 PE=2 SV=3
5	P59538	5.58e-163	457	309	0.839	0.812	T2R31_HUMAN Taste receptor type 2 member 31 OS=Homo sapiens OX=9606 GN=TAS2R31 PE=2 SV=2
6	P59544	3.12e-141	402	299	0.682	0.682	T2R50_HUMAN Taste receptor type 2 member 50 OS=Homo sapiens OX=9606 GN=TAS2R50 PE=2 SV=2
7	P59543	2.20e-139	397	309	0.682	0.660	T2R20_HUMAN Taste receptor type 2 member 20 OS=Homo sapiens OX=9606 GN=TAS2R20 PE=2 SV=2
8	Q496D7	2.26e-138	395	309	0.682	0.660	Q496D7_HUMAN Taste receptor type 2 OS=Homo sapiens OX=9606 GN=TAS2R49 PE=2 SV=1
9	P59542	6.76e-136	388	299	0.652	0.652	T2R19_HUMAN Taste receptor type 2 member 19 OS=Homo sapiens OX=9606 GN=TAS2R19 PE=1 SV=1
10	Q9NYV9	2.92e-75	234	303	0.448	0.442	T2R13_HUMAN Taste receptor type 2 member 13 OS=Homo sapiens OX=9606 GN=TAS2R13 PE=1 SV=1
11	Q7M712	3.79e-63	204	333	0.415	0.372	TR110_MOUSE Taste receptor type 2 member 110 OS=Mus musculus OX=10090 GN=Tas2r110 PE=3 SV=1
12	Q9JKE8	9.18e-62	201	333	0.405	0.363	TR110_RAT Taste receptor type 2 member 110 OS=Rattus norvegicus OX=10116 GN=Tas2r110 PE=1 SV=2
13	Q9NYV8	2.09e-60	196	317	0.441	0.416	T2R14_HUMAN Taste receptor type 2 member 14 OS=Homo sapiens OX=9606 GN=TAS2R14 PE=1 SV=1
14	Q9JKF0	1.77e-59	194	333	0.421	0.378	TR123_RAT Taste receptor type 2 member 123 OS=Rattus norvegicus OX=10116 GN=Tas2r123 PE=1 SV=1
15	Q9NYW3	4.65e-56	185	318	0.378	0.355	TA2R7_HUMAN Taste receptor type 2 member 7 OS=Homo sapiens OX=9606 GN=TAS2R7 PE=1 SV=1
16	Q9JKT7	1.92e-55	183	305	0.391	0.384	T2R13_RAT Taste receptor type 2 member 13 OS=Rattus norvegicus OX=10116 GN=Tas2r13 PE=1 SV=1
17	Q7M717	1.38e-53	179	329	0.385	0.350	TR102_MOUSE Taste receptor type 2 member 102 OS=Mus musculus OX=10090 GN=Tas2r102 PE=3 SV=1
18	P59528	1.51e-52	177	333	0.418	0.375	TR123_MOUSE Taste receptor type 2 member 123 OS=Mus musculus OX=10090 GN=Tas2r123 PE=2 SV=2
19	Q9JKT6	5.71e-50	169	314	0.388	0.369	Q9JKT6_RAT Taste receptor type 2 OS=Rattus norvegicus OX=10116 GN=Tas2r13 PE=2 SV=1
20	Q9JKE9	2.44e-48	165	312	0.381	0.365	TA2R7_RAT Taste receptor type 2 member 7 OS=Rattus norvegicus OX=10116 GN=Tas2r7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05296 TAS2R	1.3e-80	282.3	Taste receptor protein (TAS2R)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003829652.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003822192.1	0.600	Taste 1 receptor member 1
2	9597.XP_003814485.1	0.596	Taste receptor type 1 member 2
3	9597.XP_003829546.1	0.583	Polycystin 1 like 3, transient receptor potential channel interacting
4	9597.XP_003809536.1	0.558	Taste 1 receptor member 3
5	9597.XP_003825515.1	0.557	Polycystin 2 like 1, transient receptor potential cation channel
6	9597.XP_003826613.1	0.539	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.
7	9597.XP_003846259.1	0.533	Hyperpolarization activated cyclic nucleotide gated potassium channel 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0033038	1.000	bitter taste receptor activity
GO:0005488	0.968	binding
GO:0005515	0.876	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050913	0.999	sensory perception of bitter taste
GO:0050912	0.996	detection of chemical stimulus involved in sensory perception of taste
GO:0009987	0.392	cellular process
GO:0001580	0.372	detection of chemical stimulus involved in sensory perception of bitter taste
GO:0065007	0.362	biological regulation
GO:0023052	0.362	signaling
GO:0007154	0.362	cell communication
GO:0007186	0.350	G protein-coupled receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]