StarFunc result for job id P59544

User Input

>input (299 residues)
MITFLYIFFSILIMVLFVLGNFANGFIALVNFIDWVKRKKISSADQILTALAVSRIGLLW
ALLLNWYLTVLNPAFYSVELRITSYNAWVVTNHFSMWLAANLSIFYLLKIANFSNLLFLH
LKRRVRSVILVILLGTLIFLVCHLLVANMDESMWAEEYEGNMTGKMKLRNTVHLSYLTVT
TLWSFIPFTLSLISFLMLICSLCKHLKKMQLHGEGSQDLSTKVHIKALQTLISFLLLCAI
FFLFLIVSVWSPRRLRNDPVVMVSKAVGNIYLAFDSFILIWRTKKLKHTFLLILCQIRC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59544	1.000	1.000	2.838E-37	299	1.000	1.000	P59544.pdb.gz	T2R50_HUMAN Taste receptor type 2 member 50 OS=Homo sapiens OX=9606 GN=TAS2R50 PE=2 SV=2
2	AFDB:P59538	0.936	0.907	2.196E-26	309	0.689	0.667	P59538.pdb.gz	T2R31_HUMAN Taste receptor type 2 member 31 OS=Homo sapiens OX=9606 GN=TAS2R31 PE=2 SV=2
3	AFDB:P59537	0.934	0.905	6.687E-26	309	0.682	0.660	P59537.pdb.gz	T2R43_HUMAN Taste receptor type 2 member 43 OS=Homo sapiens OX=9606 GN=TAS2R43 PE=2 SV=2
4	AFDB:P59540	0.923	0.895	8.735E-26	309	0.702	0.680	P59540.pdb.gz	T2R46_HUMAN Taste receptor type 2 member 46 OS=Homo sapiens OX=9606 GN=TAS2R46 PE=1 SV=2
5	AFDB:P59541	0.924	0.869	1.491E-25	319	0.686	0.643	P59541.pdb.gz	T2R30_HUMAN Taste receptor type 2 member 30 OS=Homo sapiens OX=9606 GN=TAS2R30 PE=2 SV=3
6	AFDB:P59539	0.936	0.936	3.039E-25	299	0.682	0.682	P59539.pdb.gz	T2R45_HUMAN Taste receptor type 2 member 45 OS=Homo sapiens OX=9606 GN=TAS2R45 PE=2 SV=1
7	AFDB:P59542	0.936	0.936	9.675E-25	299	0.649	0.649	P59542.pdb.gz	T2R19_HUMAN Taste receptor type 2 member 19 OS=Homo sapiens OX=9606 GN=TAS2R19 PE=1 SV=1
8	AFDB:P59543	0.928	0.900	9.376E-24	309	0.645	0.625	P59543.pdb.gz	T2R20_HUMAN Taste receptor type 2 member 20 OS=Homo sapiens OX=9606 GN=TAS2R20 PE=2 SV=2
9	PDB:7xp4R	0.825	0.825	1.468E-22	299	0.692	0.692	7xp4R.pdb.gz
10	AFDB:Q9NYV9	0.899	0.887	1.542E-19	303	0.441	0.436	Q9NYV9.pdb.gz	T2R13_HUMAN Taste receptor type 2 member 13 OS=Homo sapiens OX=9606 GN=TAS2R13 PE=1 SV=1
11	AFDB:Q9JKT7	0.860	0.844	1.212E-17	305	0.405	0.397	Q9JKT7.pdb.gz	T2R13_RAT Taste receptor type 2 member 13 OS=Rattus norvegicus OX=10116 GN=Tas2r13 PE=1 SV=1
12	PDB:6iblA	0.648	0.508	3.130E-5	397	0.154	0.116	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
13	PDB:7sk8A	0.618	0.606	3.273E-5	306	0.147	0.144	7sk8A.pdb.gz	Structures of atypical chemokine receptor 3 reveal the basis for its promiscuity and signaling bias.
14	PDB:7wv9R	0.627	0.643	3.422E-5	290	0.124	0.128	7wv9R.pdb.gz	Molecular mechanism of allosteric modulation for the cannabinoid receptor CB1.
15	PDB:6osaR	0.703	0.660	3.578E-5	321	0.144	0.134	6osaR.pdb.gz	Conformational transitions of a neurotensin receptor 1-Gi1complex.
16	PDB:7ezmD	0.709	0.699	3.741E-5	304	0.124	0.122	7ezmD.pdb.gz	Ligand recognition and G-protein coupling selectivity of cholecystokinin A receptor
17	PDB:6lw5A	0.596	0.438	6.105E-5	427	0.147	0.103	6lw5A.pdb.gz	Structural basis of ligand binding modes at the human formyl peptide receptor 2.
18	PDB:7x9cR	0.648	0.642	7.296E-5	302	0.130	0.129	7x9cR.pdb.gz
19	PDB:7xt8R	0.674	0.684	7.976E-5	294	0.157	0.160	7xt8R.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
20	PDB:6lfmR	0.652	0.637	8.718E-5	307	0.167	0.163	6lfmR.pdb.gz	Structural basis of CXC chemokine receptor 2 activation and signalling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59544	0.0	596	299	1.000	1.000	T2R50_HUMAN Taste receptor type 2 member 50 OS=Homo sapiens OX=9606 GN=TAS2R50 PE=2 SV=2
2	P59540	1.56e-145	413	309	0.702	0.680	T2R46_HUMAN Taste receptor type 2 member 46 OS=Homo sapiens OX=9606 GN=TAS2R46 PE=1 SV=2
3	P59541	2.80e-141	402	319	0.686	0.643	T2R30_HUMAN Taste receptor type 2 member 30 OS=Homo sapiens OX=9606 GN=TAS2R30 PE=2 SV=3
4	P59539	3.12e-141	402	299	0.682	0.682	T2R45_HUMAN Taste receptor type 2 member 45 OS=Homo sapiens OX=9606 GN=TAS2R45 PE=2 SV=1
5	P59537	4.06e-141	402	309	0.682	0.660	T2R43_HUMAN Taste receptor type 2 member 43 OS=Homo sapiens OX=9606 GN=TAS2R43 PE=2 SV=2
6	P59542	1.27e-131	377	299	0.649	0.649	T2R19_HUMAN Taste receptor type 2 member 19 OS=Homo sapiens OX=9606 GN=TAS2R19 PE=1 SV=1
7	Q496D7	3.37e-131	377	309	0.642	0.621	Q496D7_HUMAN Taste receptor type 2 OS=Homo sapiens OX=9606 GN=TAS2R49 PE=2 SV=1
8	P59543	3.34e-130	374	309	0.642	0.621	T2R20_HUMAN Taste receptor type 2 member 20 OS=Homo sapiens OX=9606 GN=TAS2R20 PE=2 SV=2
9	P59538	9.43e-125	360	309	0.689	0.667	T2R31_HUMAN Taste receptor type 2 member 31 OS=Homo sapiens OX=9606 GN=TAS2R31 PE=2 SV=2
10	Q9NYV9	1.25e-72	227	303	0.438	0.432	T2R13_HUMAN Taste receptor type 2 member 13 OS=Homo sapiens OX=9606 GN=TAS2R13 PE=1 SV=1
11	Q7M712	9.29e-67	213	333	0.435	0.390	TR110_MOUSE Taste receptor type 2 member 110 OS=Mus musculus OX=10090 GN=Tas2r110 PE=3 SV=1
12	Q9JKE8	2.08e-65	210	333	0.421	0.378	TR110_RAT Taste receptor type 2 member 110 OS=Rattus norvegicus OX=10116 GN=Tas2r110 PE=1 SV=2
13	Q9JKF0	8.87e-63	203	333	0.438	0.393	TR123_RAT Taste receptor type 2 member 123 OS=Rattus norvegicus OX=10116 GN=Tas2r123 PE=1 SV=1
14	Q9NYV8	9.17e-63	202	317	0.445	0.420	T2R14_HUMAN Taste receptor type 2 member 14 OS=Homo sapiens OX=9606 GN=TAS2R14 PE=1 SV=1
15	Q9JKT6	2.05e-60	196	314	0.415	0.395	Q9JKT6_RAT Taste receptor type 2 OS=Rattus norvegicus OX=10116 GN=Tas2r13 PE=2 SV=1
16	Q7M717	3.91e-60	196	329	0.411	0.374	TR102_MOUSE Taste receptor type 2 member 102 OS=Mus musculus OX=10090 GN=Tas2r102 PE=3 SV=1
17	P59528	1.89e-57	189	333	0.431	0.387	TR123_MOUSE Taste receptor type 2 member 123 OS=Mus musculus OX=10090 GN=Tas2r123 PE=2 SV=2
18	Q9JKT7	1.88e-55	183	305	0.421	0.413	T2R13_RAT Taste receptor type 2 member 13 OS=Rattus norvegicus OX=10116 GN=Tas2r13 PE=1 SV=1
19	Q9NYW3	9.26e-52	174	318	0.375	0.352	TA2R7_HUMAN Taste receptor type 2 member 7 OS=Homo sapiens OX=9606 GN=TAS2R7 PE=1 SV=1
20	Q9NYW2	4.64e-46	159	309	0.358	0.346	TA2R8_HUMAN Taste receptor type 2 member 8 OS=Homo sapiens OX=9606 GN=TAS2R8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05296 TAS2R	9.3e-79	276.3	Taste receptor protein (TAS2R)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000424040

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352717	0.920	Olfactory receptor 13G1
2	9606.ENSP00000357494	0.909	Proto-oncogene tyrosine-protein kinase ROS
3	9606.ENSP00000425556	0.903	Palladin
4	9606.ENSP00000331867	0.781	Taste receptor type 1 member 1
5	9606.ENSP00000364520	0.775	Taste receptor type 1 member 2
6	9606.ENSP00000344411	0.752	Taste receptor type 1 member 3
7	9606.ENSP00000354414	0.682	Zinc finger protein 627
8	9606.ENSP00000330338	0.681	Olfactory receptor 52L1
9	9606.ENSP00000252835	0.635	Olfactory receptor 11H1
10	9606.ENSP00000420194	0.620	Extracellular calcium-sensing receptor
11	9606.ENSP00000287152	0.602	Kinesin-like protein KIF6
12	9606.ENSP00000317482	0.602	Olfactory receptor 4F4
13	9606.ENSP00000231188	0.600	Metabotropic glutamate receptor 6
14	9606.ENSP00000259455	0.600	Gamma-aminobutyric acid type B receptor subunit 2
15	9606.ENSP00000344173	0.600	Metabotropic glutamate receptor 8
16	9606.ENSP00000350348	0.600	Metabotropic glutamate receptor 7
17	9606.ENSP00000355316	0.600	Metabotropic glutamate receptor 3
18	9606.ENSP00000366233	0.600	Gamma-aminobutyric acid type B receptor subunit 1
19	9606.ENSP00000378492	0.600	Metabotropic glutamate receptor 2
20	9606.ENSP00000440556	0.600	Metabotropic glutamate receptor 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0033038	1.000	bitter taste receptor activity
GO:0005488	0.968	binding
GO:0005515	0.906	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050913	0.999	sensory perception of bitter taste
GO:0050912	0.999	detection of chemical stimulus involved in sensory perception of taste
GO:0065007	0.453	biological regulation
GO:0050789	0.418	regulation of biological process
GO:0009987	0.409	cellular process
GO:0050794	0.404	regulation of cellular process
GO:0001580	0.372	detection of chemical stimulus involved in sensory perception of bitter taste
GO:0007154	0.313	cell communication
GO:0051716	0.311	cellular response to stimulus
GO:0023052	0.303	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]