StarFunc result for job id P59646

User Input

>input (89 residues)
MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGK
CKCKSSQKQHSPVPEKAIPLITPGSATTC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59646	1.000	1.000	1.229E-13	89	1.000	1.000	P59646.pdb.gz	FXYD4_HUMAN FXYD domain-containing ion transport regulator 4 OS=Homo sapiens OX=9606 GN=FXYD4 PE=3 SV=2
2	AFDB:Q61835	0.566	0.572	7.055E-7	88	0.596	0.602	Q61835.pdb.gz	FXYD3_MOUSE FXYD domain-containing ion transport regulator 3 OS=Mus musculus OX=10090 GN=Fxyd3 PE=1 SV=1
3	AFDB:Q63113	0.522	0.532	1.754E-6	87	0.640	0.655	Q63113.pdb.gz	FXYD4_RAT FXYD domain-containing ion transport regulator 4 OS=Rattus norvegicus OX=10116 GN=Fxyd4 PE=1 SV=1
4	AFDB:Q14802	0.569	0.579	3.220E-6	87	0.528	0.540	Q14802.pdb.gz	FXYD3_HUMAN FXYD domain-containing ion transport regulator 3 OS=Homo sapiens OX=9606 GN=FXYD3 PE=1 SV=1
5	AFDB:O08589	0.593	0.576	3.391E-2	92	0.281	0.272	O08589.pdb.gz	PLM_RAT Phospholemman OS=Rattus norvegicus OX=10116 GN=Fxyd1 PE=1 SV=2
6	AFDB:P58549	0.468	0.517	1.670E-1	80	0.247	0.275	P58549.pdb.gz	FXYD7_HUMAN FXYD domain-containing ion transport regulator 7 OS=Homo sapiens OX=9606 GN=FXYD7 PE=1 SV=1
7	AFDB:Q0VG99	0.242	0.067	1.670E-1	397	0.202	0.045	Q0VG99.pdb.gz	MESP2_HUMAN Mesoderm posterior protein 2 OS=Homo sapiens OX=9606 GN=MESP2 PE=1 SV=2
8	AFDB:Q5N802	0.319	0.068	1.202	481	0.157	0.029	Q5N802.pdb.gz	Q5N802_ORYSJ BHLH transcription factor OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0915600 PE=1 SV=1
9	AFDB:A0A024R3P9	0.328	0.079	1.297	528	0.146	0.025	A0A024R3P9.pdb.gz
10	AFDB:F8VRH6	0.330	0.266	1.399	114	0.146	0.114	F8VRH6.pdb.gz	F8VRH6_HUMAN receptor protein serine/threonine kinase OS=Homo sapiens OX=9606 GN=TGFBR1 PE=1 SV=2
11	PDB:2pfjB	0.141	0.106	5.275	130	0.079	0.054	2pfjB.pdb.gz	The structural basis of Holliday junction resolution by T7 endonuclease I.
12	PDB:6id1I	0.184	0.043	6.140	576	0.135	0.021	6id1I.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
13	PDB:7qski	0.292	0.221	6.140	127	0.157	0.110	7qski.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
14	PDB:2q0oD	0.324	0.330	6.624	87	0.112	0.115	2q0oD.pdb.gz	Structural basis for antiactivation in bacterial quorum sensing.
15	PDB:4gwpD	0.366	0.283	6.624	121	0.135	0.099	4gwpD.pdb.gz
16	PDB:6hivCR	0.347	0.112	6.624	314	0.157	0.045	6hivCR.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
17	PDB:7bt6r	0.192	0.087	7.146	230	0.101	0.039	7bt6r.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
18	PDB:7aqwp	0.391	0.375	7.710	93	0.079	0.075	7aqwp.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
19	PDB:6ylgb	0.356	0.066	8.318	613	0.146	0.021	6ylgb.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
20	PDB:7ohrr	0.235	0.142	8.318	159	0.169	0.094	7ohrr.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59646	5.36e-61	182	89	1.000	1.000	FXYD4_HUMAN FXYD domain-containing ion transport regulator 4 OS=Homo sapiens OX=9606 GN=FXYD4 PE=3 SV=2
2	Q63113	6.46e-30	103	87	0.640	0.655	FXYD4_RAT FXYD domain-containing ion transport regulator 4 OS=Rattus norvegicus OX=10116 GN=Fxyd4 PE=1 SV=1
3	Q61835	2.26e-24	89.4	88	0.517	0.523	FXYD3_MOUSE FXYD domain-containing ion transport regulator 3 OS=Mus musculus OX=10090 GN=Fxyd3 PE=1 SV=1
4	Q14802	3.23e-24	89.0	87	0.539	0.552	FXYD3_HUMAN FXYD domain-containing ion transport regulator 3 OS=Homo sapiens OX=9606 GN=FXYD3 PE=1 SV=1
5	Q9D2W0	5.59e-16	68.2	88	0.573	0.580	FXYD4_MOUSE FXYD domain-containing ion transport regulator 4 OS=Mus musculus OX=10090 GN=Fxyd4 PE=3 SV=1
6	Q3SZX0	3.58e-13	61.2	92	0.337	0.326	PLM_BOVIN Phospholemman OS=Bos taurus OX=9913 GN=FXYD1 PE=1 SV=1
7	O00168	6.51e-13	60.5	92	0.303	0.293	PLM_HUMAN Phospholemman OS=Homo sapiens OX=9606 GN=FXYD1 PE=1 SV=2
8	P56513	2.43e-12	58.9	92	0.315	0.304	PLM_CANLF Phospholemman OS=Canis lupus familiaris OX=9615 GN=FXYD1 PE=1 SV=1
9	I3LMB3	6.88e-12	57.8	87	0.337	0.345	PLM_PIG Phospholemman OS=Sus scrofa OX=9823 GN=FXYD1 PE=1 SV=2
10	Q9D164	3.28e-10	53.5	94	0.337	0.319	FXYD6_MOUSE FXYD domain-containing ion transport regulator 6 OS=Mus musculus OX=10090 GN=Fxyd6 PE=1 SV=2
11	Q9H0Q3	4.27e-09	50.8	95	0.236	0.221	FXYD6_HUMAN FXYD domain-containing ion transport regulator 6 OS=Homo sapiens OX=9606 GN=FXYD6 PE=1 SV=1
12	Q58K79	1.21e-07	46.2	65	0.258	0.354	Q58K79_PIG FXYD domain-containing ion transport regulator OS=Sus scrofa OX=9823 GN=FXYD2 PE=1 SV=1
13	P54710	3.66e-06	42.7	66	0.191	0.258	ATNG_HUMAN Sodium/potassium-transporting ATPase subunit gamma OS=Homo sapiens OX=9606 GN=FXYD2 PE=1 SV=3
14	Q04679	5.11e-06	42.4	66	0.258	0.348	ATNG_RAT Sodium/potassium-transporting ATPase subunit gamma OS=Rattus norvegicus OX=10116 GN=Fxyd2 PE=2 SV=2
15	Q96DB9	5.59e-06	44.3	178	0.191	0.096	FXYD5_HUMAN FXYD domain-containing ion transport regulator 5 OS=Homo sapiens OX=9606 GN=FXYD5 PE=1 SV=2
16	P58549	8.46e-06	42.0	80	0.213	0.237	FXYD7_HUMAN FXYD domain-containing ion transport regulator 7 OS=Homo sapiens OX=9606 GN=FXYD7 PE=1 SV=1
17	Q04646	7.68e-05	39.3	70	0.236	0.300	ATNG_MOUSE Sodium/potassium-transporting ATPase subunit gamma OS=Mus musculus OX=10090 GN=Fxyd2 PE=1 SV=2
18	B0S4R4	2.07e-04	38.1	70	0.169	0.214	B0S4R4_SALSA FXYD domain-containing ion transport regulator OS=Salmo salar OX=8030 GN=fxyd11b PE=2 SV=1
19	B0S4R3	2.33e-04	38.1	70	0.169	0.214	B0S4R3_SALSA FXYD domain-containing ion transport regulator OS=Salmo salar OX=8030 GN=fxyd11a PE=2 SV=1
20	O08589	2.67e-04	38.5	92	0.236	0.228	PLM_RAT Phospholemman OS=Rattus norvegicus OX=10116 GN=Fxyd1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02038 ATP1G1_PLM_MAT8	9.5e-21	84.3	ATP1G1/PLM/MAT8 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483791

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315070	0.950	Gap junction delta-4 protein
2	9606.ENSP00000292079	0.842	Sodium/potassium-transporting ATPase subunit gamma
3	9606.ENSP00000482442	0.831	FXYD domain containing ion transport regulator 6
4	9606.ENSP00000270310	0.805	FXYD domain containing ion transport regulator 7
5	9606.ENSP00000344254	0.702	FXYD domain-containing ion transport regulator 5
6	9606.ENSP00000356790	0.675	Sodium/potassium-transporting ATPase subunit beta-1
7	9606.ENSP00000286371	0.663	Sodium/potassium-transporting ATPase subunit beta-3
8	9606.ENSP00000357060	0.640	Sodium/potassium-transporting ATPase subunit alpha-4
9	9606.ENSP00000445306	0.630	Sodium/potassium-transporting ATPase subunit alpha-1
10	9606.ENSP00000250111	0.616	Sodium/potassium-transporting ATPase subunit beta-2
11	9606.ENSP00000354490	0.610	Sodium/potassium-transporting ATPase subunit alpha-2
12	9606.ENSP00000444688	0.604	Sodium/potassium-transporting ATPase subunit alpha-3
13	9606.ENSP00000218008	0.545	Protein ATP1B4
14	9606.ENSP00000353104	0.513	Dehydrodolichyl diphosphate synthase complex subunit DHDDS
15	9606.ENSP00000303423	0.512	Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0022857	0.971	transmembrane transporter activity
GO:0015318	0.903	inorganic molecular entity transmembrane transporter activity
GO:0015075	0.872	monoatomic ion transmembrane transporter activity
GO:0019899	0.802	enzyme binding
GO:1901702	0.799	salt transmembrane transporter activity
GO:0022890	0.651	inorganic cation transmembrane transporter activity
GO:0008324	0.640	monoatomic cation transmembrane transporter activity
GO:0046873	0.634	metal ion transmembrane transporter activity
GO:0051117	0.444	ATPase binding
GO:0015267	0.415	channel activity
GO:0005216	0.371	monoatomic ion channel activity
GO:0015079	0.362	potassium ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051234	0.980	establishment of localization
GO:0006810	0.927	transport
GO:0065007	0.850	biological regulation
GO:0009987	0.803	cellular process
GO:0006811	0.689	monoatomic ion transport
GO:0050789	0.643	regulation of biological process
GO:0050794	0.357	regulation of cellular process
GO:0055085	0.349	transmembrane transport
GO:0098660	0.311	inorganic ion transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.907	protein-containing complex
GO:0043226	0.685	organelle
GO:0043227	0.649	membrane-bounded organelle
GO:0005622	0.586	intracellular anatomical structure
GO:1903561	0.347	extracellular vesicle
GO:0070062	0.335	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	0.362	K(+)(in) = K(+)(out)

[back to server]