StarFunc result for job id P59861

User Input

>input (70 residues)
MRVLFFVFGVLSLMFTVPPARSFISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLK
IIEIDGQKKW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59861	1.000	1.000	6.480E-14	70	1.000	1.000	P59861.pdb.gz	D131A_HUMAN Beta-defensin 131A OS=Homo sapiens OX=9606 GN=DEFB131A PE=1 SV=2
2	AFDB:Q8NES8	0.443	0.437	7.683E-4	71	0.229	0.225	Q8NES8.pdb.gz	DB124_HUMAN Beta-defensin 124 OS=Homo sapiens OX=9606 GN=DEFB124 PE=1 SV=2
3	AFDB:Q8NET1	0.477	0.459	9.505E-4	73	0.229	0.219	Q8NET1.pdb.gz	D108B_HUMAN Beta-defensin 108B OS=Homo sapiens OX=9606 GN=DEFB108B PE=1 SV=3
4	AFDB:Q95LI0	0.447	0.282	1.455E-3	123	0.229	0.130	Q95LI0.pdb.gz	DB118_MACMU Defensin beta 118 OS=Macaca mulatta OX=9544 GN=DEFB118 PE=2 SV=1
5	AFDB:Q8WTQ1	0.512	0.500	2.566E-3	72	0.271	0.264	Q8WTQ1.pdb.gz	D104A_HUMAN Beta-defensin 104 OS=Homo sapiens OX=9606 GN=DEFB104A PE=1 SV=2
6	AFDB:Q96PH6	0.448	0.269	2.566E-3	123	0.243	0.138	Q96PH6.pdb.gz	DB118_HUMAN Defensin beta 118 OS=Homo sapiens OX=9606 GN=DEFB118 PE=1 SV=1
7	AFDB:Q8N690	0.418	0.352	3.174E-3	84	0.229	0.190	Q8N690.pdb.gz	DB119_HUMAN Beta-defensin 119 OS=Homo sapiens OX=9606 GN=DEFB119 PE=2 SV=2
8	AFDB:Q30KQ6	0.498	0.503	5.599E-3	69	0.257	0.261	Q30KQ6.pdb.gz	DB114_HUMAN Beta-defensin 114 OS=Homo sapiens OX=9606 GN=DEFB114 PE=1 SV=1
9	AFDB:Q7Z7B7	0.416	0.315	6.011E-3	95	0.243	0.179	Q7Z7B7.pdb.gz	DB132_HUMAN Beta-defensin 132 OS=Homo sapiens OX=9606 GN=DEFB132 PE=1 SV=1
10	AFDB:Q5J5C9	0.368	0.340	6.927E-3	76	0.214	0.197	Q5J5C9.pdb.gz	DB121_HUMAN Beta-defensin 121 OS=Homo sapiens OX=9606 GN=DEFB121 PE=1 SV=1
11	PDB:2lwlA	0.336	0.505	1.917E-1	45	0.100	0.156	2lwlA.pdb.gz
12	PDB:6cs9A	0.346	0.537	5.964E-1	41	0.100	0.171	6cs9A.pdb.gz	Human beta-defensin 2 killsCandida albicansthrough phosphatidylinositol 4,5-bisphosphate-mediated membrane permeabilization.
13	PDB:1e4rA	0.298	0.509	1.397	35	0.114	0.229	1e4rA.pdb.gz
14	PDB:1kj6A	0.328	0.484	1.855	45	0.114	0.178	1kj6A.pdb.gz
15	PDB:1bnbA	0.340	0.547	2.464	38	0.100	0.184	1bnbA.pdb.gz
16	PDB:7ac7A	0.150	0.133	5.377	84	0.100	0.083	7ac7A.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
17	PDB:2af6G	0.188	0.062	6.196	246	0.057	0.016	2af6G.pdb.gz	Structure of the Mycobacterium tuberculosis Flavin Dependent Thymidylate Synthase (MtbThyX) at 2.0A Resolution.
18	PDB:2xvaA	0.101	0.055	6.196	199	0.114	0.040	2xvaA.pdb.gz	Structure and Mechanism of the Chalcogen Detoxifying Protein Tehb from Escherichia Coli.
19	PDB:4lecA	0.114	0.061	7.666	202	0.029	0.010	4lecA.pdb.gz	The Crystal Structure of Human Methyltransferase-Like Protein 21A in Complex with SAH
20	PDB:6eznF	0.237	0.034	7.666	650	0.043	0.005	6eznF.pdb.gz	Molecular basis for glycan recognition and reaction priming of eukaryotic oligosaccharyltransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59861	3.16e-48	148	70	1.000	1.000	D131A_HUMAN Beta-defensin 131A OS=Homo sapiens OX=9606 GN=DEFB131A PE=1 SV=2
2	Q30KQ6	0.004	34.3	69	0.257	0.261	DB114_HUMAN Beta-defensin 114 OS=Homo sapiens OX=9606 GN=DEFB114 PE=1 SV=1
3	Q9H1M3	0.069	32.3	183	0.286	0.109	DB129_HUMAN Beta-defensin 129 OS=Homo sapiens OX=9606 GN=DEFB129 PE=1 SV=1
4	Q6IV18	0.31	29.6	89	0.271	0.213	GLL13_CHICK Gallinacin-13 OS=Gallus gallus OX=9031 GN=GAL13 PE=2 SV=1
5	Q9I7F7	0.86	29.3	1337	0.171	0.009	ACKL_DROME Activated Cdc42 kinase-like OS=Drosophila melanogaster OX=7227 GN=Ack-like PE=1 SV=3
6	Q02858	2.1	28.1	1122	0.200	0.012	TIE2_MOUSE Angiopoietin-1 receptor OS=Mus musculus OX=10090 GN=Tek PE=1 SV=2
7	Q9M3C9	2.1	28.1	280	0.171	0.043	Q9M3C9_ARATH NAC domain containing protein 63 OS=Arabidopsis thaliana OX=3702 GN=NAC063 PE=2 SV=1
8	A0A0N9WLX3	3.3	26.6	67	0.300	0.313	A0A0N9WLX3_CHICK Beta-defensin 9 OS=Gallus gallus gallus OX=208526 GN=BD-9 PE=2 SV=1
9	Q6QLR1	3.3	26.6	67	0.300	0.313	GLL9_CHICK Gallinacin-9 OS=Gallus gallus OX=9031 GN=GAL9 PE=2 SV=1
10	Q94AR8	4.7	27.3	509	0.157	0.022	LEUC_ARATH 3-isopropylmalate dehydratase large subunit, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=IIL1 PE=1 SV=1
11	A0KYQ7	4.8	27.3	386	0.186	0.034	AGAS_SHESA D-galactosamine-6-phosphate deaminase AgaS OS=Shewanella sp. (strain ANA-3) OX=94122 GN=agaS PE=1 SV=1
12	Q940I2	5.0	26.9	339	0.200	0.041	Q940I2_ARATH Thioredoxin family protein OS=Arabidopsis thaliana OX=3702 GN=MED24.18 PE=1 SV=1
13	Q09022	8.4	25.8	84	0.229	0.190	XEN1_XENLA Xenoxin-1 OS=Xenopus laevis OX=8355 GN=xenoxin-1 PE=1 SV=1
14	P17629	9.0	26.6	752	0.186	0.017	HPR1_YEAST THO complex subunit HPR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HPR1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13841 Defensin_beta_2	0.00047	31.9	Beta defensin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335538

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253381	0.956	Beta-defensin 118
2	9606.ENSP00000360190	0.955	Beta-defensin 110
3	9606.ENSP00000383396	0.954	Beta-defensin 116
4	9606.ENSP00000381703	0.944	Beta-defensin 113
5	9606.ENSP00000326309	0.941	Beta-defensin 124
6	9606.ENSP00000371643	0.940	Beta-defensin 135
7	9606.ENSP00000383398	0.931	Beta-defensin 115
8	9606.ENSP00000335382	0.929	Beta-defensin 128
9	9606.ENSP00000312702	0.904	Beta-defensin 114
10	9606.ENSP00000297439	0.903	Beta-defensin 1
11	9606.ENSP00000319126	0.903	Beta-defensin 112
12	9606.ENSP00000365486	0.903	Beta-defensin 123
13	9606.ENSP00000417128	0.903	Beta-defensin 121
14	9606.ENSP00000246105	0.902	Beta-defensin 129
15	9606.ENSP00000365492	0.902	Defensin beta 119
16	9606.ENSP00000371644	0.902	Beta-defensin 136
17	9606.ENSP00000371825	0.902	Beta-defensin 127
18	9606.ENSP00000371835	0.902	Beta-defensin 126
19	9606.ENSP00000297435	0.900	Neutrophil defensin 4
20	9606.ENSP00000297436	0.900	Defensin-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008289	0.424	lipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0045087	0.988	innate immune response
GO:0009617	0.969	response to bacterium
GO:0050789	0.966	regulation of biological process
GO:0009987	0.954	cellular process
GO:0006959	0.902	humoral immune response
GO:0050794	0.899	regulation of cellular process
GO:0042742	0.863	defense response to bacterium
GO:0019730	0.836	antimicrobial humoral response
GO:0042221	0.801	response to chemical
GO:0050829	0.799	defense response to Gram-negative bacterium
GO:0048518	0.750	positive regulation of biological process
GO:0051716	0.733	cellular response to stimulus
GO:0001817	0.664	regulation of cytokine production
GO:0061844	0.625	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0032101	0.611	regulation of response to external stimulus
GO:0050830	0.506	defense response to Gram-positive bacterium
GO:0001819	0.497	positive regulation of cytokine production
GO:0032103	0.494	positive regulation of response to external stimulus
GO:2000147	0.484	positive regulation of cell motility
GO:0070887	0.443	cellular response to chemical stimulus
GO:0032642	0.362	regulation of chemokine production
GO:0002684	0.357	positive regulation of immune system process
GO:0002685	0.356	regulation of leukocyte migration
GO:0010033	0.351	response to organic substance
GO:0071675	0.351	regulation of mononuclear cell migration
GO:0050920	0.349	regulation of chemotaxis
GO:0002687	0.346	positive regulation of leukocyte migration
GO:0050921	0.336	positive regulation of chemotaxis
GO:0032722	0.324	positive regulation of chemokine production
GO:0071677	0.318	positive regulation of mononuclear cell migration
GO:0002690	0.318	positive regulation of leukocyte chemotaxis
GO:0002697	0.305	regulation of immune effector process
GO:0071216	0.305	cellular response to biotic stimulus
GO:0002237	0.303	response to molecule of bacterial origin
GO:0031640	0.302	killing of cells of another organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.995	extracellular space
GO:0070013	0.522	intracellular organelle lumen
GO:0012505	0.492	endomembrane system
GO:0043227	0.351	membrane-bounded organelle
GO:0043231	0.321	intracellular membrane-bounded organelle
GO:0031982	0.317	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]