StarFunc result for job id P59901

User Input

>input (499 residues)
MTLILTSLLFFGLSLGPRTRVQAENLPKPILWAEPGPVITWHNPVTIWCQGTLEAQGYRL
DKEGNSMSRHILKTLESENKVKLSIPSMMWEHAGRYHCYYQSPAGWSEPSDPLELVVTAY
SRPTLSALPSPVVTSGVNVTLRCASRLGLGRFTLIEEGDHRLSWTLNSHQHNHGKFQALF
PMGPLTFSNRGTFRCYGYENNTPYVWSEPSDPLQLLVSGVSRKPSLLTLQGPVVTPGENL
TLQCGSDVGYIRYTLYKEGADGLPQRPGRQPQAGLSQANFTLSPVSRSYGGQYRCYGAHN
VSSEWSAPSDPLDILIAGQISDRPSLSVQPGPTVTSGEKVTLLCQSWDPMFTFLLTKEGA
AHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSRSSNPYLLSHPSEPLELVVSGA
TETLNPAQKKSDSKTAPHLQDYTVENLIRMGVAGLVLLFLGILLFEAQHSQRSPPRCSQE
ANSRKDNAPFRVVEPWEQI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59901	1.000	1.000	5.665E-100	499	1.000	1.000	P59901.pdb.gz	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
2	AFDB:O75022	0.755	0.612	5.370E-68	631	0.655	0.518	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
3	AFDB:Q8N149	0.630	0.646	1.444E-67	483	0.629	0.650	Q8N149.pdb.gz	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
4	AFDB:O75019	0.610	0.620	1.470E-64	489	0.645	0.658	O75019.pdb.gz	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
5	AFDB:O75023	0.647	0.561	2.548E-62	590	0.567	0.480	O75023.pdb.gz	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
6	AFDB:Q8N423	0.626	0.536	2.654E-61	598	0.581	0.485	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
7	AFDB:Q8NHL6	0.679	0.537	4.957E-61	650	0.587	0.451	Q8NHL6.pdb.gz	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
8	AFDB:Q8N6C8	0.632	0.704	2.130E-60	439	0.579	0.658	Q8N6C8.pdb.gz	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
9	AFDB:P97484	0.632	0.400	1.813E-55	841	0.461	0.273	P97484.pdb.gz	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
10	AFDB:P43629	0.485	0.540	2.806E-34	444	0.277	0.311	P43629.pdb.gz	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
11	PDB:5oj2B	0.166	0.129	1.358E-11	692	0.144	0.104	5oj2B.pdb.gz
12	PDB:7q1yA	0.164	0.075	3.292E-11	1374	0.128	0.047	7q1yA.pdb.gz
13	PDB:1e07A	0.163	0.134	1.836E-10	642	0.130	0.101	1e07A.pdb.gz
14	PDB:5a42A	0.166	0.065	1.635E-9	1597	0.104	0.033	5a42A.pdb.gz
15	PDB:1zvoC	0.178	0.174	3.963E-9	512	0.134	0.131	1zvoC.pdb.gz
16	PDB:7q5zA	0.157	0.071	4.633E-9	1344	0.078	0.029	7q5zA.pdb.gz
17	PDB:7vonA	0.170	0.076	4.633E-9	1399	0.118	0.042	7vonA.pdb.gz
18	PDB:1hzhH	0.167	0.180	6.332E-9	457	0.112	0.123	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
19	PDB:4rtdA	0.164	0.089	6.332E-9	1122	0.112	0.050	4rtdA.pdb.gz
20	PDB:2rcjC	0.174	0.168	1.457E-8	523	0.150	0.143	2rcjC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75019	0.0	591	489	0.647	0.661	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
2	O75022	0.0	608	631	0.617	0.488	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
3	P59901	0.0	1023	499	0.998	0.998	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
4	Q8N149	0.0	570	483	0.633	0.654	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
5	Q8N423	0.0	529	597	0.567	0.474	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
6	Q8N6C8	0.0	546	439	0.583	0.663	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
7	Q8NHL6	6.53e-179	519	650	0.551	0.423	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
8	O75023	1.07e-177	513	590	0.545	0.461	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
9	P97484	2.29e-132	405	841	0.437	0.259	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
10	Q8K4V6	4.94e-130	395	697	0.437	0.313	Q8K4V6_MOUSE Paired immunoglobulin-like receptor B (Fragment) OS=Mus musculus OX=10090 GN=Pirb PE=1 SV=1
11	A6NI73	5.65e-85	266	299	0.283	0.472	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
12	Q8NHJ6	1.31e-72	239	448	0.261	0.290	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
13	P43630	1.92e-65	220	455	0.271	0.297	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
14	Q8N743	1.61e-64	216	410	0.261	0.317	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
15	Q14943	2.32e-64	215	382	0.275	0.359	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
16	P43629	3.63e-64	216	444	0.265	0.297	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
17	Q61450	1.63e-63	210	303	0.222	0.366	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1
18	Q64281	2.07e-62	209	335	0.238	0.355	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
19	Q28109	1.86e-53	183	264	0.246	0.466	Q28109_BOVIN FC gamma 2 receptor OS=Bos taurus OX=9913 PE=1 SV=1
20	Q8C567	8.69e-48	170	325	0.194	0.298	NCTR1_MOUSE Natural cytotoxicity triggering receptor 1 OS=Mus musculus OX=10090 GN=Ncr1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	1.2e+02	13.8	Adenovirus E3 region protein CR1
2	PF07679 I-set	6.6	18.2	Immunoglobulin I-set domain
3	PF00047 ig	4.3e-18	76.6	Immunoglobulin domain
4	PF13895 Ig_2	2.1e-25	100.2	Immunoglobulin domain
5	PF13927 Ig_3	9.2e-18	75.9	Immunoglobulin domain
6	PF16680 Ig_4	15	17.6	T-cell surface glycoprotein CD3 delta chain
7	PF07686 V-set	0.15	23.6	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000291759

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252593	0.993	Bone marrow stromal antigen 2
2	9606.ENSP00000289902	0.991	High affinity immunoglobulin epsilon receptor subunit gamma
3	9606.ENSP00000271450	0.880	Low affinity immunoglobulin gamma Fc region receptor II-a
4	9606.ENSP00000356946	0.878	Low affinity immunoglobulin gamma Fc region receptor III-A
5	9606.ENSP00000433642	0.864	Low affinity immunoglobulin gamma Fc region receptor III-B
6	9606.ENSP00000351497	0.853	Low affinity immunoglobulin gamma Fc region receptor II-b
7	9606.ENSP00000358165	0.845	High affinity immunoglobulin gamma Fc receptor I
8	9606.ENSP00000364907	0.763	Tyrosine-protein kinase SYK
9	9606.ENSP00000440428	0.715	C-type lectin domain family 4 member C
10	9606.ENSP00000412927	0.693	HLA class I histocompatibility antigen, alpha chain G
11	9606.ENSP00000259951	0.674	HLA class I histocompatibility antigen, alpha chain F
12	9606.ENSP00000365817	0.661	HLA class I histocompatibility antigen, alpha chain E
13	9606.ENSP00000391592	0.656	Tyrosine-protein phosphatase non-receptor type 6
14	9606.ENSP00000365402	0.652	HLA class I histocompatibility antigen, Cw-7 alpha chain
15	9606.ENSP00000399168	0.641	HLA class I histocompatibility antigen, B-7 alpha chain
16	9606.ENSP00000379873	0.639	HLA class I histocompatibility antigen, A-3 alpha chain
17	9606.ENSP00000370034	0.618	Toll-like receptor 7
18	9606.ENSP00000452780	0.616	Beta-2-microglobulin
19	9606.ENSP00000262629	0.612	TYRO protein tyrosine kinase-binding protein
20	9606.ENSP00000327890	0.583	Interleukin-3 receptor subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding
GO:0004888	0.753	transmembrane signaling receptor activity
GO:0005102	0.615	signaling receptor binding
GO:0015026	0.305	coreceptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0009987	0.997	cellular process
GO:0050896	0.996	response to stimulus
GO:0048583	0.988	regulation of response to stimulus
GO:0007165	0.988	signal transduction
GO:0002682	0.984	regulation of immune system process
GO:0051239	0.982	regulation of multicellular organismal process
GO:0002768	0.960	immune response-regulating cell surface receptor signaling pathway
GO:0002683	0.928	negative regulation of immune system process
GO:0019222	0.919	regulation of metabolic process
GO:0006952	0.917	defense response
GO:0060255	0.914	regulation of macromolecule metabolic process
GO:0048518	0.898	positive regulation of biological process
GO:0051241	0.898	negative regulation of multicellular organismal process
GO:0001817	0.881	regulation of cytokine production
GO:0002376	0.873	immune system process
GO:0048523	0.872	negative regulation of cellular process
GO:0045088	0.872	regulation of innate immune response
GO:0048584	0.773	positive regulation of response to stimulus
GO:1903555	0.771	regulation of tumor necrosis factor superfamily cytokine production
GO:0009893	0.768	positive regulation of metabolic process
GO:0032680	0.746	regulation of tumor necrosis factor production
GO:0010604	0.722	positive regulation of macromolecule metabolic process
GO:0002684	0.711	positive regulation of immune system process
GO:0023051	0.701	regulation of signaling
GO:0010646	0.701	regulation of cell communication
GO:0048522	0.693	positive regulation of cellular process
GO:0048585	0.644	negative regulation of response to stimulus
GO:0009966	0.592	regulation of signal transduction
GO:0050778	0.528	positive regulation of immune response
GO:0006955	0.503	immune response
GO:0051240	0.478	positive regulation of multicellular organismal process
GO:0010628	0.465	positive regulation of gene expression
GO:0032501	0.464	multicellular organismal process
GO:0001819	0.454	positive regulation of cytokine production
GO:0009605	0.400	response to external stimulus
GO:0009607	0.385	response to biotic stimulus
GO:0044419	0.376	biological process involved in interspecies interaction between organisms
GO:0050865	0.362	regulation of cell activation
GO:0045321	0.345	leukocyte activation
GO:0031348	0.317	negative regulation of defense response
GO:0051707	0.316	response to other organism
GO:0032102	0.313	negative regulation of response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0031982	0.901	vesicle
GO:0012505	0.890	endomembrane system
GO:0031410	0.871	cytoplasmic vesicle
GO:0032991	0.852	protein-containing complex
GO:0098796	0.537	membrane protein complex
GO:0098797	0.523	plasma membrane protein complex
GO:0031090	0.442	organelle membrane
GO:0030659	0.418	cytoplasmic vesicle membrane
GO:0098588	0.392	bounding membrane of organelle
GO:0030141	0.359	secretory granule
GO:0030667	0.339	secretory granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]