StarFunc result for job id P59910

User Input

>input (316 residues)
MGQDYYSVLGITRNSEDAQIKQAYRRLALKHHPLKSNEPSSAEIFRQIAEAYDVLSDPMK
RGIYDKFGEEGLKGGIPLEFGSQTPWTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSE
VDLNFGGLQGRGVKKQDPQVERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDKIL
TIDVKPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGK
ALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGEGMPLPEDPTKKGDLFIFFDIQFPT
RLTPQKKQMLRQALLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59910	1.000	1.000	1.369E-70	316	1.000	1.000	P59910.pdb.gz	DJB13_HUMAN DnaJ homolog subfamily B member 13 OS=Homo sapiens OX=9606 GN=DNAJB13 PE=1 SV=1
2	AFDB:Q80Y75	0.718	0.718	4.327E-64	316	0.899	0.899	Q80Y75.pdb.gz	DJB13_MOUSE DnaJ homolog subfamily B member 13 OS=Mus musculus OX=10090 GN=Dnajb13 PE=1 SV=1
3	AFDB:O75953	0.561	0.511	3.344E-46	348	0.506	0.460	O75953.pdb.gz	DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens OX=9606 GN=DNAJB5 PE=1 SV=1
4	AFDB:Q9UDY4	0.558	0.525	1.072E-44	337	0.484	0.454	Q9UDY4.pdb.gz	DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens OX=9606 GN=DNAJB4 PE=1 SV=1
5	AFDB:B0K030	0.574	0.534	1.642E-44	340	0.522	0.485	B0K030.pdb.gz	B0K030_RAT DnaJ (Hsp40) homolog, subfamily B, member 1 (Predicted), isoform CRA_b OS=Rattus norvegicus OX=10116 GN=Dnajb1 PE=2 SV=1
6	AFDB:B8JM56	0.563	0.525	2.225E-44	340	0.468	0.435	B8JM56.pdb.gz
7	AFDB:A0A0R4IYH3	0.577	0.545	8.060E-43	335	0.465	0.439	A0A0R4IYH3.pdb.gz
8	AFDB:Q24133	0.556	0.526	3.073E-42	334	0.437	0.413	Q24133.pdb.gz	DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster OX=7227 GN=DnaJ-1 PE=1 SV=3
9	AFDB:Q20774	0.556	0.532	4.428E-42	331	0.465	0.444	Q20774.pdb.gz	Q20774_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-13 PE=1 SV=1
10	AFDB:O96212	0.540	0.521	1.447E-38	328	0.449	0.433	O96212.pdb.gz	O96212_PLAF7 Protein SIS1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0213100 PE=4 SV=1
11	PDB:6byrA	0.211	0.165	8.461E-6	405	0.130	0.101	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:7x3kA	0.196	0.234	2.425E-3	262	0.085	0.103	7x3kA.pdb.gz
13	PDB:2y4uA	0.165	0.126	2.167E-2	424	0.082	0.061	2y4uA.pdb.gz
14	PDB:5y88T	0.168	0.440	2.448E-2	107	0.066	0.196	5y88T.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
15	PDB:1fpoA	0.171	0.300	7.777E-2	171	0.044	0.082	1fpoA.pdb.gz
16	PDB:7sqcO1	0.171	0.097	1.345E-1	673	0.108	0.051	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
17	PDB:2z5bA	0.107	0.193	1.937E-1	127	0.054	0.134	2z5bA.pdb.gz
18	PDB:2wamA	0.092	0.096	3.152E-1	294	0.085	0.092	2wamA.pdb.gz
19	PDB:7sqcO0	0.168	0.072	4.272E-1	1140	0.098	0.027	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:1dlmA	0.086	0.087	4.825E-1	309	0.149	0.152	1dlmA.pdb.gz	The 1.8 A crystal structure of catechol 1,2-dioxygenase reveals a novel hydrophobic helical zipper as a subunit linker.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59910	0.0	647	316	1.000	1.000	DJB13_HUMAN DnaJ homolog subfamily B member 13 OS=Homo sapiens OX=9606 GN=DNAJB13 PE=1 SV=1
2	Q80Y75	0.0	591	316	0.899	0.899	DJB13_MOUSE DnaJ homolog subfamily B member 13 OS=Mus musculus OX=10090 GN=Dnajb13 PE=1 SV=1
3	O75953	1.50e-97	293	348	0.497	0.451	DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens OX=9606 GN=DNAJB5 PE=1 SV=1
4	Q9UDY4	1.82e-97	293	337	0.481	0.451	DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens OX=9606 GN=DNAJB4 PE=1 SV=1
5	P25685	6.48e-97	291	340	0.519	0.482	DNJB1_HUMAN DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=4
6	Q6FHS4	6.48e-97	291	340	0.519	0.482	Q6FHS4_HUMAN DNAJB1 protein (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB1 PE=2 SV=1
7	O89114	1.33e-96	291	348	0.494	0.448	DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus OX=10090 GN=Dnajb5 PE=2 SV=1
8	Q9QYJ3	6.64e-96	289	340	0.525	0.488	DNJB1_MOUSE DnaJ homolog subfamily B member 1 OS=Mus musculus OX=10090 GN=Dnajb1 PE=1 SV=3
9	B0K030	7.65e-96	288	340	0.525	0.488	B0K030_RAT DnaJ (Hsp40) homolog, subfamily B, member 1 (Predicted), isoform CRA_b OS=Rattus norvegicus OX=10116 GN=Dnajb1 PE=2 SV=1
10	Q6DEJ4	8.10e-96	288	335	0.475	0.448	Q6DEJ4_DANRE DnaJ (Hsp40) homolog, subfamily B, member 1 OS=Danio rerio OX=7955 GN=dnajb1 PE=2 SV=1
11	Q7ZVY8	1.11e-93	283	337	0.478	0.448	Q7ZVY8_DANRE DnaJ homolog subfamily B member 1 OS=Danio rerio OX=7955 GN=zgc:55492 PE=1 SV=1
12	Q20774	2.81e-87	266	331	0.453	0.432	Q20774_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-13 PE=1 SV=1
13	Q24133	4.09e-82	253	334	0.449	0.425	DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster OX=7227 GN=DnaJ-1 PE=1 SV=3
14	D3ZUU5	4.56e-75	236	371	0.443	0.377	D3ZUU5_RAT DnaJ heat shock protein family (Hsp40) member B1 OS=Rattus norvegicus OX=10116 GN=Dnajb1 PE=4 SV=1
15	O96212	1.17e-73	231	328	0.440	0.424	O96212_PLAF7 Protein SIS1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0213100 PE=4 SV=1
16	M0QXK0	5.33e-71	223	273	0.411	0.476	M0QXK0_HUMAN DnaJ heat shock protein family (Hsp40) member B1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=2
17	Q8I489	5.05e-64	209	402	0.405	0.318	Q8I489_PLAF7 Heat shock protein 40, type II OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0501100.1 PE=4 SV=2
18	O96123	3.86e-60	199	421	0.396	0.297	O96123_PLAF7 Knob associated heat shock protein 40 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0201800 PE=4 SV=3
19	O76224	1.81e-51	174	336	0.373	0.351	O76224_9TRYP Chaperone OS=Trypanosoma brucei OX=5691 GN=DNAJ PE=4 SV=1
20	Q38AB7	1.81e-51	174	336	0.373	0.351	Q38AB7_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2000 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00226 DnaJ	1.3e-18	78.1	DnaJ domain
2	PF01556 DnaJ_C	3.4e-36	136.0	DnaJ C terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344431

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351646	0.905	Stress-induced-phosphoprotein 1
2	9606.ENSP00000402000	0.862	Septin-4
3	9606.ENSP00000378199	0.801	Heat shock-related 70 kDa protein 2
4	9606.ENSP00000432083	0.789	Heat shock cognate 71 kDa protein
5	9606.ENSP00000381461	0.780	Protein phosphatase methylesterase 1
6	9606.ENSP00000364802	0.776	Heat shock 70 kDa protein 1A
7	9606.ENSP00000364805	0.772	Heat shock 70 kDa protein 1-like
8	9606.ENSP00000364801	0.771	Heat shock protein family A member 1B
9	9606.ENSP00000318687	0.770	Heat shock protein 105 kDa
10	9606.ENSP00000302961	0.768	Heat shock protein family A member 4
11	9606.ENSP00000324173	0.759	78 kDa glucose-regulated protein
12	9606.ENSP00000296464	0.754	Heat shock 70 kDa protein 4L
13	9606.ENSP00000294053	0.740	Caseinolytic peptidase B protein homolog
14	9606.ENSP00000262375	0.737	DnaJ homolog subfamily A member 3, mitochondrial
15	9606.ENSP00000335153	0.737	Heat shock protein HSP 90-alpha
16	9606.ENSP00000360609	0.729	Heat shock protein HSP 90-beta
17	9606.ENSP00000297185	0.677	Stress-70 protein, mitochondrial
18	9606.ENSP00000367623	0.661	Heat shock 70 kDa protein 14
19	9606.ENSP00000252655	0.649	Radial spoke head protein 3 homolog
20	9606.ENSP00000301364	0.649	Pre-rRNA-processing protein TSR1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.977	cellular process
GO:0071840	0.895	cellular component organization or biogenesis
GO:0016043	0.880	cellular component organization
GO:0060271	0.842	cilium assembly
GO:0001578	0.825	microtubule bundle formation
GO:0035082	0.673	axoneme assembly
GO:0065007	0.490	biological regulation
GO:0050789	0.444	regulation of biological process
GO:0050794	0.355	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.996	intracellular anatomical structure
GO:0005929	0.996	cilium
GO:0097729	0.982	9+2 motile cilium
GO:0005737	0.975	cytoplasm
GO:0043229	0.953	intracellular organelle
GO:0043232	0.890	intracellular non-membrane-bounded organelle
GO:0036126	0.873	sperm flagellum
GO:0043231	0.799	intracellular membrane-bounded organelle
GO:0005856	0.655	cytoskeleton
GO:0005634	0.483	nucleus
GO:0005829	0.406	cytosol
GO:0097014	0.346	ciliary plasm
GO:0005930	0.337	axoneme

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]