StarFunc result for job id P59923

User Input

>input (1031 residues)
MPPGRWHAAYPAQAQSSRERGRLQTVKKEEEDESYTPVQAARPQTLNRPGQELFRQLFRQ
LRYHESSGPLETLSRLRELCRWWLRPDVLSKAQILELLVLEQFLSILPGELRVWVQLHNP
ESGEEAVALLEELQRDLDGTSWRDPGPAQSPDVHWMGTGALRSAQIWSLASPLRSSSALG
DHLEPPYEIEARDFLAGQSDTPAAQMPALFPREGCPGDQVTPTRSLTAQLQETMTFKDVE
VTFSQDEWGWLDSAQRNLYRDVMLENYRNMASLVGPFTKPALISWLEAREPWGLNMQAAQ
PKGNPVAAPTGDDLQSKTNKFILNQEPLEEAETLAVSSGCPATSVSEGIGLRESFQQKSR
QKDQCENPIQVRVKKEETNFSHRTGKDSEVSGSNSLDLKHVTYLRVSGRKESLKHGCGKH
FRMSSHHYDYKKYGKGLRHMIGGFSLHQRIHSGLKGNKKDVCGKDFSLSSHHQRGQSLHT
VGVSFKCSDCGRTFSHSSHLAYHQRLHTQEKAFKCRVCGKAFRWSSNCARHEKIHTGVKP
YKCDLCEKAFRRLSAYRLHRETHAKKKFLELNQYRAALTYSSGFDHHLGDQSGEKLFDCS
QCRKSFHCKSYVLEHQRIHTQEKPYKCTKCRKTFRWRSNFTRHMRLHEEEKFYKQDECRE
GFRQSPDCSQPQGAPAVEKTFLCQQCGKTFTRKKTLVDHQRIHTGEKPYQCSDCGKDFAY
RSAFIVHKKKHAMKRKPEGGPSFSQDTVFQVPQSSHSKEEPYKCSQCGKAFRNHSFLLIH
QRVHTGEKPYKCRECGKAFRWSSNLYRHQRIHSLQKQYDCHESEKTPNVEPKILTGEKRF
WCQECGKTFTRKRTLLDHKGIHSGEKRYKCNLCGKSYDRNYRLVNHQRIHSTERPFKCQW
CGKEFIGRHTLSSHQRKHTRAAQAERSPPARSSSQDTKLRLQKLKPSEEMPLEDCKEACS
QSSRLTGLQDISIGKKCHKCSICGKTFNKSSQLISHKRFHTRERPFKCSKCGKTFRWSSN
LARHMKNHIRD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59923	1.000	1.000	0.000	1031	1.000	1.000	P59923.pdb.gz	ZN445_HUMAN Zinc finger protein 445 OS=Homo sapiens OX=9606 GN=ZNF445 PE=1 SV=1
2	AFDB:Q8R2V3	0.137	0.143	1.413E-89	986	0.593	0.620	Q8R2V3.pdb.gz	ZN445_MOUSE Zinc finger protein 445 OS=Mus musculus OX=10090 GN=Znf445 PE=2 SV=2
3	AFDB:A0A024R4T5	0.198	0.261	9.518E-44	734	0.254	0.357	A0A024R4T5.pdb.gz
4	AFDB:A2AWF2	0.142	0.203	1.620E-39	685	0.236	0.355	A2AWF2.pdb.gz	A2AWF2_MOUSE Reduced expression 2 OS=Mus musculus OX=10090 GN=Rex2 PE=1 SV=1
5	AFDB:A2A9J5	0.159	0.228	7.924E-39	645	0.235	0.375	A2A9J5.pdb.gz	A2A9J5_MOUSE Zinc finger protein 980 OS=Mus musculus OX=10090 GN=Zfp980 PE=4 SV=1
6	AFDB:Q6ZNH5	0.181	0.324	1.441E-37	498	0.185	0.384	Q6ZNH5.pdb.gz	ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens OX=9606 GN=ZNF497 PE=1 SV=2
7	AFDB:Q9NQZ8	0.174	0.315	6.597E-34	489	0.186	0.393	Q9NQZ8.pdb.gz	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
8	AFDB:Q8N883	0.218	0.361	3.599E-33	585	0.218	0.385	Q8N883.pdb.gz	ZN614_HUMAN Zinc finger protein 614 OS=Homo sapiens OX=9606 GN=ZNF614 PE=1 SV=2
9	AFDB:Q7Z3I7	0.123	0.215	2.727E-32	529	0.179	0.350	Q7Z3I7.pdb.gz	ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens OX=9606 GN=ZNF572 PE=1 SV=1
10	AFDB:Q86UD4	0.168	0.281	2.880E-32	541	0.195	0.372	Q86UD4.pdb.gz	ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens OX=9606 GN=ZNF329 PE=1 SV=2
11	PDB:3w5kB	0.053	0.241	3.949E-3	110	0.043	0.400	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:3javA	0.064	0.037	5.748E-1	2327	0.113	0.050	3javA.pdb.gz
13	PDB:6gawAp	0.034	0.113	9.407E-1	190	0.025	0.137	6gawAp.pdb.gz	Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
14	PDB:7r24A	0.070	0.411	1.109	150	0.012	0.080	7r24A.pdb.gz
15	PDB:4cabA	0.040	0.064	1.380	507	0.012	0.024	4cabA.pdb.gz	Structure of the Mono-Functional Heme Catalase Dr1998 from Deinococcus Radiodurans
16	PDB:7pntO	0.033	0.105	1.814	197	0.028	0.147	7pntO.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
17	PDB:7ru9C	0.051	0.146	1.916	271	0.019	0.074	7ru9C.pdb.gz	Structural insights into metazoan pretargeting GET complexes.
18	PDB:6rw4O	0.031	0.098	2.138	194	0.030	0.160	6rw4O.pdb.gz	Distinct pre-initiation steps in human mitochondrial translation.
19	PDB:4i43A	0.037	0.084	2.258	334	0.014	0.042	4i43A.pdb.gz
20	PDB:7vdvX	0.029	0.097	2.520	252	0.032	0.131	7vdvX.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59923	0.0	2145	1031	1.000	1.000	ZN445_HUMAN Zinc finger protein 445 OS=Homo sapiens OX=9606 GN=ZNF445 PE=1 SV=1
2	Q8R2V3	0.0	1122	986	0.583	0.610	ZN445_MOUSE Zinc finger protein 445 OS=Mus musculus OX=10090 GN=Znf445 PE=2 SV=2
3	Q05481	8.55e-152	484	1191	0.320	0.277	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
4	P17038	1.88e-139	440	809	0.283	0.361	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
5	Q9P0L1	2.92e-137	433	754	0.287	0.393	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
6	Q14587	2.46e-136	436	947	0.298	0.324	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
7	P51523	1.26e-134	425	738	0.274	0.383	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
8	Q8TAQ5	8.24e-133	419	688	0.247	0.371	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
9	A8K8Y5	1.16e-132	419	707	0.262	0.382	A8K8Y5_HUMAN cDNA FLJ78762, highly similar to Homo sapiens zinc finger protein 224, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
10	Q9NZL3	1.35e-132	419	707	0.262	0.382	ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens OX=9606 GN=ZNF224 PE=1 SV=3
11	Q9UK10	1.69e-129	411	706	0.270	0.394	ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens OX=9606 GN=ZNF225 PE=1 SV=2
12	Q7TMN8	3.66e-129	405	578	0.233	0.415	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
13	Q8BLA2	1.14e-128	404	578	0.232	0.413	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
14	A6NNF4	9.41e-128	403	616	0.253	0.424	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
15	Q9P2J8	5.35e-126	406	865	0.221	0.264	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
16	Q8IYB9	7.78e-125	397	648	0.237	0.377	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
17	Q6ECI4	3.50e-124	397	717	0.250	0.360	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
18	Q5TYW1	5.39e-124	406	1059	0.233	0.227	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
19	Q96JF6	8.90e-123	396	807	0.244	0.312	ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens OX=9606 GN=ZNF594 PE=2 SV=3
20	Q6ZR52	2.83e-122	390	646	0.237	0.378	ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens OX=9606 GN=ZNF493 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01352 KRAB	2.2e-18	76.9	KRAB box
2	PF02023 SCAN	3.4e-32	121.4	SCAN domain
3	PF00096 zf-C2H2	2.2e-47	168.0	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	6.7e-29	109.1	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	1.2e-05	36.4	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	1.9	20.1	Zinc-finger double-stranded RNA-binding
7	PF13465 zf-H2C2_2	8.5e-59	204.8	Zinc-finger double domain
8	PF12874 zf-met	34	16.2	Zinc-finger of C2H2 type
9	PF09723 Zn-ribbon_8	0.00023	32.5	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000413073

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341539	0.784	T-cell activation inhibitor, mitochondrial
2	9606.ENSP00000302310	0.674	Zinc finger protein 396
3	9606.ENSP00000316891	0.607	LIM and calponin homology domains 1
4	9606.ENSP00000270328	0.550	A disintegrin and metalloproteinase with thrombospondin motifs 10
5	9606.ENSP00000482374	0.517	Proline-rich protein 36
6	9606.ENSP00000321447	0.503	Olfactory receptor 4S1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0010385	0.989	double-stranded methylated DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0010468	0.984	regulation of gene expression
GO:0048519	0.966	negative regulation of biological process
GO:0009987	0.959	cellular process
GO:0009892	0.924	negative regulation of metabolic process
GO:0010605	0.912	negative regulation of macromolecule metabolic process
GO:0071704	0.896	organic substance metabolic process
GO:0044238	0.881	primary metabolic process
GO:0044237	0.851	cellular metabolic process
GO:0043170	0.843	macromolecule metabolic process
GO:0051171	0.840	regulation of nitrogen compound metabolic process
GO:0080090	0.838	regulation of primary metabolic process
GO:0006807	0.836	nitrogen compound metabolic process
GO:0031323	0.836	regulation of cellular metabolic process
GO:0051128	0.772	regulation of cellular component organization
GO:0019219	0.742	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.721	negative regulation of cellular process
GO:0071840	0.709	cellular component organization or biogenesis
GO:0016043	0.696	cellular component organization
GO:1902275	0.681	regulation of chromatin organization
GO:0051252	0.676	regulation of RNA metabolic process
GO:0006325	0.619	chromatin organization
GO:0034641	0.604	cellular nitrogen compound metabolic process
GO:0009889	0.602	regulation of biosynthetic process
GO:0006355	0.578	regulation of DNA-templated transcription
GO:0090304	0.505	nucleic acid metabolic process
GO:0044260	0.490	cellular macromolecule metabolic process
GO:0051172	0.393	negative regulation of nitrogen compound metabolic process
GO:0031324	0.393	negative regulation of cellular metabolic process
GO:0048518	0.329	positive regulation of biological process
GO:0048522	0.324	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.830	nuclear lumen
GO:0005654	0.793	nucleoplasm
GO:0005737	0.359	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]