StarFunc result for job id P60059

User Input

>input (68 residues)
MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIP
INNIIVGG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P60058	0.999	0.999	3.941E-9	68	1.000	1.000	P60058.pdb.gz	SC61G_CANLF Protein transport protein Sec61 subunit gamma OS=Canis lupus familiaris OX=9615 GN=SEC61G PE=1 SV=1
2	AFDB:Q9VWE9	0.964	0.964	1.018E-7	68	0.838	0.838	Q9VWE9.pdb.gz	S61G2_DROME Protein transport protein Sec61 gamma-2 subunit OS=Drosophila melanogaster OX=7227 GN=Sec61gamma PE=3 SV=1
3	PDB:2wwbB	0.664	0.664	1.344E-7	68	1.000	1.000	2wwbB.pdb.gz	Structure of Monomeric Yeast and Mammalian Sec61 Complexes Interacting with the Translating Ribosome.
4	AFDB:Q19967	0.980	0.980	2.156E-7	68	0.853	0.853	Q19967.pdb.gz	EMO1_CAEEL Protein transport protein Sec61 subunit gamma OS=Caenorhabditis elegans OX=6239 GN=sec-61.G PE=2 SV=1
5	AFDB:Q9SMP2	0.979	0.965	5.571E-6	69	0.632	0.623	Q9SMP2.pdb.gz	S61G3_ARATH Protein transport protein Sec61 subunit gamma-3 OS=Arabidopsis thaliana OX=3702 GN=SEC61G3 PE=1 SV=1
6	AFDB:Q09827	0.944	0.918	5.027E-4	70	0.485	0.471	Q09827.pdb.gz	SC61G_SCHPO Probable protein transport protein Sec61 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sss1 PE=3 SV=1
7	AFDB:P35179	0.702	0.612	1.486E-3	80	0.426	0.362	P35179.pdb.gz	SC61G_YEAST Protein transport protein SSS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSS1 PE=1 SV=2
8	AFDB:Q06344	0.426	0.064	8.668	628	0.147	0.016	Q06344.pdb.gz	ESF1_YEAST Pre-rRNA-processing protein ESF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ESF1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P60058	2.82e-44	138	68	1.000	1.000	SC61G_CANLF Protein transport protein Sec61 subunit gamma OS=Canis lupus familiaris OX=9615 GN=SEC61G PE=1 SV=1
2	P60059	2.82e-44	138	68	1.000	1.000	SC61G_HUMAN Protein transport protein Sec61 subunit gamma OS=Homo sapiens OX=9606 GN=SEC61G PE=1 SV=1
3	Q19967	4.80e-38	122	68	0.853	0.853	EMO1_CAEEL Protein transport protein Sec61 subunit gamma OS=Caenorhabditis elegans OX=6239 GN=sec-61.G PE=2 SV=1
4	Q9VWE9	2.78e-37	120	68	0.838	0.838	S61G2_DROME Protein transport protein Sec61 gamma-2 subunit OS=Drosophila melanogaster OX=7227 GN=Sec61gamma PE=3 SV=1
5	Q9SMP2	2.19e-27	95.5	69	0.632	0.623	S61G3_ARATH Protein transport protein Sec61 subunit gamma-3 OS=Arabidopsis thaliana OX=3702 GN=SEC61G3 PE=1 SV=1
6	Q09827	1.37e-19	75.9	70	0.485	0.471	SC61G_SCHPO Probable protein transport protein Sec61 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sss1 PE=3 SV=1
7	P35179	1.27e-15	66.2	80	0.441	0.375	SC61G_YEAST Protein transport protein SSS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSS1 PE=1 SV=2
8	B1PVV8	2.3	28.1	3898	0.176	0.003	B1PVV8_9FLAV Genome polyprotein OS=Classical swine fever virus OX=11096 PE=1 SV=1
9	F2X8A1	2.3	28.1	3898	0.176	0.003	F2X8A1_9FLAV Genome polyprotein OS=Classical swine fever virus OX=11096 PE=1 SV=1
10	P21530	2.3	28.1	3898	0.176	0.003	POLG_CSFVB Genome polyprotein OS=Classical swine fever virus (strain Brescia) OX=11098 PE=1 SV=1
11	Q5U8X5	2.3	28.1	3898	0.176	0.003	Q5U8X5_9FLAV Genome polyprotein OS=Classical swine fever virus OX=11096 PE=1 SV=2
12	Q68871	2.3	28.1	3898	0.176	0.003	Q68871_9FLAV Genome polyprotein OS=Classical swine fever virus - Alfort/187 OX=358769 PE=1 SV=1
13	Q9YS30	2.3	28.1	3898	0.176	0.003	Q9YS30_9FLAV Genome polyprotein OS=Classical swine fever virus OX=11096 PE=1 SV=2
14	P19712	2.5	28.1	3898	0.176	0.003	POLG_CSFVA Genome polyprotein OS=Classical swine fever virus (strain Alfort) OX=11097 PE=1 SV=2
15	Q9VQH2	5.8	26.9	1537	0.147	0.007	DUOX_DROME Dual oxidase OS=Drosophila melanogaster OX=7227 GN=Duox PE=1 SV=2
16	Q9Y5X1	6.2	26.9	595	0.221	0.025	SNX9_HUMAN Sorting nexin-9 OS=Homo sapiens OX=9606 GN=SNX9 PE=1 SV=1
17	P39734	6.5	26.6	528	0.176	0.023	HPH2_YEAST Protein HPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FRT2 PE=1 SV=2
18	P41988	7.2	26.6	549	0.176	0.022	TCPA_CAEEL T-complex protein 1 subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cct-1 PE=3 SV=2
19	A0A8I6A3C7	7.6	26.6	628	0.221	0.024	A0A8I6A3C7_RAT Sorting nexin OS=Rattus norvegicus OX=10116 GN=Snx9 PE=1 SV=1
20	A0A8I6AC77	7.6	26.6	594	0.221	0.025	A0A8I6AC77_RAT Sorting nexin OS=Rattus norvegicus OX=10116 GN=Snx9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10032 Pho88	2.4e+02	12.4	Phosphate transport (Pho88)
2	PF00584 SecE	3.2e-13	60.7	SecE/Sec61-gamma subunits of protein translocation complex

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006069693.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006040098.1	0.999	Protein transport protein Sec61 subunit beta-like
2	89462.XP_006077806.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 25 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 26 samples with support for all annotated introns
3	89462.XP_006078903.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 26 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
4	89462.XP_006063493.1	0.997	Protein transport protein Sec61 subunit beta
5	89462.XP_006075417.1	0.984	Translocation protein SEC63 homolog
6	89462.XP_006049341.1	0.975	60S ribosomal protein L35
7	89462.XP_006045084.1	0.971	60S ribosomal protein L29
8	89462.XP_006059412.1	0.970	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
9	89462.XP_006056556.1	0.954	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 ESTs, 9 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
10	89462.XP_006071069.1	0.954	Uncharacterized protein LOC102401365
11	89462.XP_006056019.1	0.952	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
12	89462.XP_006042139.1	0.950	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
13	89462.XP_006056310.1	0.950	60S ribosomal protein L38-like
14	89462.XP_006053856.1	0.941	60S ribosomal protein L35-like
15	89462.XP_006048594.1	0.935	Stress-associated endoplasmic reticulum protein 1
16	89462.XP_006046787.1	0.926	40S ribosomal protein S28
17	89462.XP_006077432.1	0.923	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 22 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 29 samples with support for all annotated introns
18	89462.XP_006051884.1	0.917	60S ribosomal protein L36a-like
19	89462.XP_006051909.1	0.917	60S ribosomal protein L36a
20	89462.XP_006053917.1	0.917	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008320	1.000	protein transmembrane transporter activity
GO:0005515	0.997	protein binding
GO:0005543	0.997	phospholipid binding
GO:0043021	0.995	ribonucleoprotein complex binding
GO:0043022	0.993	ribosome binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0045184	0.939	establishment of protein localization
GO:0006810	0.893	transport
GO:0015031	0.876	protein transport
GO:0006886	0.869	intracellular protein transport
GO:0033365	0.681	protein localization to organelle
GO:0070972	0.665	protein localization to endoplasmic reticulum
GO:0072599	0.601	establishment of protein localization to endoplasmic reticulum
GO:0006605	0.557	protein targeting
GO:0045047	0.545	protein targeting to ER
GO:0022406	0.432	membrane docking
GO:0065007	0.397	biological regulation
GO:0050789	0.357	regulation of biological process
GO:0050794	0.330	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.997	endomembrane system
GO:0005829	0.997	cytosol
GO:0032991	0.943	protein-containing complex
GO:0031090	0.908	organelle membrane
GO:0005783	0.892	endoplasmic reticulum
GO:0031984	0.886	organelle subcompartment
GO:0005789	0.883	endoplasmic reticulum membrane
GO:0043232	0.753	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]