StarFunc result for job id P60174

User Input

>input (249 residues)
MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI
AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAE
GLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P00939	1.000	1.000	1.536E-55	249	0.984	0.984	P00939.pdb.gz	TPIS_RABIT Triosephosphate isomerase OS=Oryctolagus cuniculus OX=9986 GN=TPI1 PE=1 SV=3
2	AFDB:P00940	0.990	0.994	2.969E-50	248	0.884	0.887	P00940.pdb.gz	TPIS_CHICK Triosephosphate isomerase OS=Gallus gallus OX=9031 GN=TPI1 PE=1 SV=2
3	PDB:1ssgA	0.987	0.995	1.593E-47	247	0.871	0.879	1ssgA.pdb.gz	Understanding protein lids: structural analysis of active hinge mutants in triosephosphate isomerase
4	PDB:1htiB	0.989	0.993	6.161E-47	248	0.996	1.000	1htiB.pdb.gz	Crystal structure of recombinant human triosephosphate isomerase at 2.8 A resolution. Triosephosphate isomerase-related human genetic disorders and comparison with the trypanosomal enzyme.
5	AFDB:A0A1L5YRA2	0.990	0.994	5.398E-45	248	0.651	0.653	A0A1L5YRA2.pdb.gz	TPIS_SCYPA Triosephosphate isomerase OS=Scylla paramamosain OX=85552 PE=1 SV=1
6	AFDB:G4V6B9	0.988	0.973	7.381E-43	253	0.647	0.636	G4V6B9.pdb.gz	G4V6B9_SCHMA Triosephosphate isomerase OS=Schistosoma mansoni OX=6183 PE=1 SV=1
7	AFDB:P29613	0.989	0.997	1.641E-42	247	0.639	0.644	P29613.pdb.gz	TPIS_DROME Triosephosphate isomerase OS=Drosophila melanogaster OX=7227 GN=Tpi PE=1 SV=3
8	PDB:6joxA	0.963	0.979	3.483E-42	245	0.643	0.653	6joxA.pdb.gz
9	AFDB:Q10657	0.980	0.988	2.041E-41	247	0.614	0.619	Q10657.pdb.gz	TPIS_CAEEL Triosephosphate isomerase OS=Caenorhabditis elegans OX=6239 GN=tpi-1 PE=1 SV=2
10	PDB:6nxwC	0.965	0.954	1.575E-40	252	0.598	0.591	6nxwC.pdb.gz
11	AFDB:P48491	0.969	0.950	2.870E-40	254	0.602	0.591	P48491.pdb.gz	TPIS_ARATH Triosephosphate isomerase, cytosolic OS=Arabidopsis thaliana OX=3702 GN=CTIMC PE=1 SV=2
12	PDB:1mo0A	0.968	0.938	1.198E-39	257	0.614	0.595	1mo0A.pdb.gz
13	AFDB:Q9SKP6	0.966	0.767	3.795E-39	315	0.622	0.492	Q9SKP6.pdb.gz	TPIC_ARATH Triosephosphate isomerase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIM PE=1 SV=1
14	AFDB:Q6FRI3	0.982	0.986	1.467E-38	248	0.506	0.508	Q6FRI3.pdb.gz	TPIS_CANGA Triosephosphate isomerase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=TPI1 PE=3 SV=1
15	AFDB:Q96VN5	0.981	0.981	1.877E-38	249	0.550	0.550	Q96VN5.pdb.gz	TPIS_PARBA Triosephosphate isomerase OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) OX=502779 GN=TPI1 PE=1 SV=3
16	PDB:7pejC	0.961	0.968	5.955E-37	247	0.530	0.534	7pejC.pdb.gz
17	PDB:4ff7A	0.973	0.981	2.036E-36	247	0.522	0.526	4ff7A.pdb.gz	Effects of a buried cysteine-to-serine mutation on yeast triosephosphate isomerase structure and stability.
18	PDB:1tpfA	0.954	0.951	3.062E-33	250	0.526	0.524	1tpfA.pdb.gz
19	PDB:2vfdA	0.952	0.959	4.049E-32	247	0.422	0.425	2vfdA.pdb.gz
20	PDB:3taoB	0.910	0.879	5.920E-28	258	0.386	0.372	3taoB.pdb.gz	Structural and functional characterization of Mycobacterium tuberculosis triosephosphate isomerase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P00939	0.0	504	249	0.984	0.984	TPIS_RABIT Triosephosphate isomerase OS=Oryctolagus cuniculus OX=9986 GN=TPI1 PE=1 SV=3
2	P60174	0.0	511	249	1.000	1.000	TPIS_HUMAN Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=4
3	P17751	1.19e-177	489	249	0.960	0.960	TPIS_MOUSE Triosephosphate isomerase OS=Mus musculus OX=10090 GN=Tpi1 PE=1 SV=5
4	P48500	3.19e-175	483	249	0.944	0.944	TPIS_RAT Triosephosphate isomerase OS=Rattus norvegicus OX=10116 GN=Tpi1 PE=1 SV=2
5	P00940	3.91e-163	453	248	0.896	0.899	TPIS_CHICK Triosephosphate isomerase OS=Gallus gallus OX=9031 GN=TPI1 PE=1 SV=2
6	A0A1L5YRA2	4.94e-117	336	248	0.651	0.653	TPIS_SCYPA Triosephosphate isomerase OS=Scylla paramamosain OX=85552 PE=1 SV=1
7	G4V6B9	2.32e-115	332	253	0.647	0.636	G4V6B9_SCHMA Triosephosphate isomerase OS=Schistosoma mansoni OX=6183 PE=1 SV=1
8	P29613	6.66e-113	326	247	0.639	0.644	TPIS_DROME Triosephosphate isomerase OS=Drosophila melanogaster OX=7227 GN=Tpi PE=1 SV=3
9	Q10657	5.80e-109	316	247	0.614	0.619	TPIS_CAEEL Triosephosphate isomerase OS=Caenorhabditis elegans OX=6239 GN=tpi-1 PE=1 SV=2
10	Q9SKP6	6.99e-107	313	315	0.622	0.492	TPIC_ARATH Triosephosphate isomerase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIM PE=1 SV=1
11	P48491	1.09e-104	305	254	0.598	0.587	TPIS_ARATH Triosephosphate isomerase, cytosolic OS=Arabidopsis thaliana OX=3702 GN=CTIMC PE=1 SV=2
12	Q96VN5	1.16e-95	282	249	0.550	0.550	TPIS_PARBA Triosephosphate isomerase OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) OX=502779 GN=TPI1 PE=1 SV=3
13	P00942	2.06e-92	274	248	0.526	0.528	TPIS_YEAST Triosephosphate isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPI1 PE=1 SV=2
14	P04828	3.90e-91	271	249	0.538	0.538	TPIS_EMENI Triosephosphate isomerase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=tpiA PE=3 SV=1
15	P07669	1.54e-90	269	249	0.530	0.530	TPIS_SCHPO Triosephosphate isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpi1 PE=1 SV=4
16	Q6FRI3	2.91e-90	268	248	0.510	0.512	TPIS_CANGA Triosephosphate isomerase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=TPI1 PE=3 SV=1
17	Q9P940	9.79e-85	254	248	0.498	0.500	TPIS_CANAL Triosephosphate isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TPI1 PE=1 SV=3
18	G8BB25	2.01e-84	253	248	0.486	0.488	G8BB25_CANPC Triosephosphate isomerase OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=CPAR2_807980 PE=3 SV=1
19	P04789	2.13e-78	238	250	0.526	0.524	TPIS_TRYBB Triosephosphate isomerase, glycosomal OS=Trypanosoma brucei brucei OX=5702 PE=1 SV=2
20	Q07412	4.80e-72	222	248	0.426	0.427	TPIS_PLAFA Triosephosphate isomerase OS=Plasmodium falciparum OX=5833 GN=TPI PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06883 RNA_pol_Rpa2_4	84	14.5	RNA polymerase I, Rpa2 specific domain
2	PF00121 TIM	9.4e-83	289.0	Triosephosphate isomerase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000229270

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229239	0.999	Glyceraldehyde-3-phosphate dehydrogenase
2	9606.ENSP00000362413	0.999	Phosphoglycerate kinase 1
3	9606.ENSP00000405573	0.999	Glucose-6-phosphate isomerase
4	9606.ENSP00000222286	0.997	Glyceraldehyde-3-phosphate dehydrogenase, testis-specific
5	9606.ENSP00000234590	0.996	Alpha-enolase
6	9606.ENSP00000305995	0.996	Phosphoglycerate kinase 2
7	9606.ENSP00000391481	0.995	Transketolase
8	9606.ENSP00000321259	0.994	Transaldolase
9	9606.ENSP00000378669	0.989	Fructose-bisphosphate aldolase A
10	9606.ENSP00000360124	0.985	Phosphoglucomutase-1
11	9606.ENSP00000226253	0.982	Belongs to the class I fructose-bisphosphate aldolase family
12	9606.ENSP00000416583	0.982	Deoxyribose-phosphate aldolase
13	9606.ENSP00000280605	0.980	Transketolase-like protein 2
14	9606.ENSP00000363988	0.980	Belongs to the class I fructose-bisphosphate aldolase family
15	9606.ENSP00000359991	0.975	Phosphoglycerate mutase 1
16	9606.ENSP00000320171	0.973	Pyruvate kinase PKM
17	9606.ENSP00000358931	0.973	Transketolase-like protein 1
18	9606.ENSP00000245206	0.971	Aspartate aminotransferase, mitochondrial
19	9606.ENSP00000324105	0.970	Beta-enolase
20	9606.ENSP00000378360	0.964	Triokinase/FMN cyclase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004807	1.000	triose-phosphate isomerase activity
GO:0005515	0.998	protein binding
GO:0042802	0.873	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0044238	0.989	primary metabolic process
GO:0006807	0.983	nitrogen compound metabolic process
GO:0034641	0.964	cellular nitrogen compound metabolic process
GO:0046483	0.960	heterocycle metabolic process
GO:0006139	0.951	nucleobase-containing compound metabolic process
GO:1901135	0.950	carbohydrate derivative metabolic process
GO:0019637	0.946	organophosphate metabolic process
GO:1901576	0.930	organic substance biosynthetic process
GO:0006753	0.926	nucleoside phosphate metabolic process
GO:0009132	0.893	nucleoside diphosphate metabolic process
GO:0006081	0.892	cellular aldehyde metabolic process
GO:0009056	0.785	catabolic process
GO:1901564	0.748	organonitrogen compound metabolic process
GO:0005975	0.718	carbohydrate metabolic process
GO:1901575	0.590	organic substance catabolic process
GO:0019752	0.451	carboxylic acid metabolic process
GO:0006163	0.412	purine nucleotide metabolic process
GO:0019693	0.407	ribose phosphate metabolic process
GO:0009141	0.405	nucleoside triphosphate metabolic process
GO:0009150	0.396	purine ribonucleotide metabolic process
GO:0006091	0.393	generation of precursor metabolites and energy
GO:0032787	0.388	monocarboxylic acid metabolic process
GO:0009185	0.324	ribonucleoside diphosphate metabolic process
GO:0046034	0.320	ATP metabolic process
GO:0006090	0.319	pyruvate metabolic process
GO:0046939	0.307	nucleotide phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043227	0.953	membrane-bounded organelle
GO:0043229	0.933	intracellular organelle
GO:0043231	0.897	intracellular membrane-bounded organelle
GO:0005576	0.643	extracellular region
GO:0005634	0.520	nucleus
GO:0031982	0.308	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18585	1.000	D-glyceraldehyde 3-phosphate = dihydroxyacetone phosphate
EC:5.3.1.1	1.000	triose-phosphate isomerase.

[back to server]