StarFunc result for job id P60228

User Input

>input (445 residues)
MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKN
LYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK
HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ
NWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQP
QYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLY
VNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKL
NMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAM
NIEKKLNQNSRSEAPNWATQDSGFY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P60228	1.000	1.000	1.072E-58	445	1.000	1.000	P60228.pdb.gz	EIF3E_HUMAN Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1
2	AFDB:O77410	0.865	0.885	2.173E-39	435	0.584	0.598	O77410.pdb.gz	EIF3E_DROME Eukaryotic translation initiation factor 3 subunit E OS=Drosophila melanogaster OX=7227 GN=eIF3e PE=1 SV=1
3	AFDB:Q9C5Z3	0.861	0.869	8.771E-37	441	0.508	0.512	Q9C5Z3.pdb.gz	EIF3E_ARATH Eukaryotic translation initiation factor 3 subunit E OS=Arabidopsis thaliana OX=3702 GN=TIF3E1 PE=1 SV=1
4	AFDB:H0YBP5	0.541	0.722	1.326E-35	332	0.744	0.997	H0YBP5.pdb.gz	H0YBP5_HUMAN Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=2
5	PDB:6fec3	0.550	0.580	2.942E-31	419	0.937	0.995	6fec3.pdb.gz	Structure of a human cap-dependent 48S translation pre-initiation complex.
6	AFDB:O94513	0.840	0.749	2.934E-30	501	0.413	0.367	O94513.pdb.gz	EIF3E_SCHPO Eukaryotic translation initiation factor 3 subunit E OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=int6 PE=1 SV=1
7	AFDB:Q4Q833	0.754	0.824	6.910E-17	405	0.236	0.259	Q4Q833.pdb.gz	Q4Q833_LEIMA Eukaryotic translation initiation factor 3 subunit E OS=Leishmania major OX=5664 GN=LMJF_28_2310 PE=3 SV=1
8	AFDB:Q383C1	0.737	0.789	1.549E-15	413	0.207	0.223	Q383C1.pdb.gz	Q383C1_TRYB2 Eukaryotic translation initiation factor 3 subunit E OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3420 PE=3 SV=1
9	AFDB:Q9GS00	0.562	0.432	5.312E-10	601	0.119	0.088	Q9GS00.pdb.gz	CSN1_CAEEL COP9 signalosome complex subunit 1 OS=Caenorhabditis elegans OX=6239 GN=csn-1 PE=1 SV=1
10	AFDB:A8K070	0.616	0.533	5.798E-10	526	0.133	0.112	A8K070.pdb.gz	A8K070_HUMAN G protein pathway suppressor 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=1
11	AFDB:Q9VVU5	0.583	0.505	1.221E-9	525	0.124	0.105	Q9VVU5.pdb.gz	CSN1_DROME COP9 signalosome complex subunit 1b OS=Drosophila melanogaster OX=7227 GN=CSN1b PE=2 SV=1
12	PDB:5l4kR	0.547	0.613	4.612E-7	389	0.135	0.154	5l4kR.pdb.gz
13	PDB:6fvtR	0.540	0.585	1.716E-6	405	0.126	0.138	6fvtR.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
14	PDB:6fyxo	0.383	0.335	2.045E-6	529	0.146	0.123	6fyxo.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
15	PDB:5mpbP	0.434	0.438	2.545E-6	440	0.133	0.134	5mpbP.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
16	PDB:3jckD	0.526	0.596	4.498E-6	384	0.128	0.148	3jckD.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
17	PDB:5l4kP	0.425	0.417	8.305E-6	456	0.137	0.134	5l4kP.pdb.gz
18	PDB:3txmA	0.389	0.464	9.895E-6	353	0.103	0.130	3txmA.pdb.gz
19	PDB:6zmwu	0.372	0.262	1.034E-5	706	0.166	0.105	6zmwu.pdb.gz	Structure of a human 48Stranslational initiation complex.
20	PDB:6r7nB	0.237	0.237	1.080E-5	443	0.133	0.133	6r7nB.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3KW56	0.0	831	396	0.890	1.000	B3KW56_HUMAN Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1
2	E5RGA2	0.0	741	352	0.791	1.000	E5RGA2_HUMAN Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1
3	E5RHS5	0.0	603	318	0.647	0.906	E5RHS5_HUMAN Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=2
4	O77410	0.0	540	435	0.589	0.602	EIF3E_DROME Eukaryotic translation initiation factor 3 subunit E OS=Drosophila melanogaster OX=7227 GN=eIF3e PE=1 SV=1
5	P60228	0.0	929	445	1.000	1.000	EIF3E_HUMAN Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1
6	P60229	0.0	929	445	1.000	1.000	EIF3E_MOUSE Eukaryotic translation initiation factor 3 subunit E OS=Mus musculus OX=10090 GN=Eif3e PE=1 SV=1
7	Q641X8	0.0	929	445	1.000	1.000	EIF3E_RAT Eukaryotic translation initiation factor 3 subunit E OS=Rattus norvegicus OX=10116 GN=Eif3e PE=2 SV=1
8	H0YBP5	1.42e-180	509	332	0.546	0.732	H0YBP5_HUMAN Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=2
9	Q9C5Z3	7.59e-160	460	441	0.515	0.519	EIF3E_ARATH Eukaryotic translation initiation factor 3 subunit E OS=Arabidopsis thaliana OX=3702 GN=TIF3E1 PE=1 SV=1
10	O94513	2.49e-111	338	501	0.429	0.381	EIF3E_SCHPO Eukaryotic translation initiation factor 3 subunit E OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=int6 PE=1 SV=1
11	Q4Q833	3.52e-38	145	405	0.211	0.232	Q4Q833_LEIMA Eukaryotic translation initiation factor 3 subunit E OS=Leishmania major OX=5664 GN=LMJF_28_2310 PE=3 SV=1
12	Q383C1	4.40e-30	122	413	0.187	0.201	Q383C1_TRYB2 Eukaryotic translation initiation factor 3 subunit E OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3420 PE=3 SV=1
13	Q94899	2.24e-04	45.8	444	0.074	0.074	CSN2_DROME COP9 signalosome complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=alien PE=1 SV=2
14	Q54HL6	0.41	35.4	449	0.045	0.045	CSN2_DICDI COP9 signalosome complex subunit 2 OS=Dictyostelium discoideum OX=44689 GN=csn2 PE=1 SV=1
15	Q8W207	0.46	35.0	439	0.040	0.041	CSN2_ARATH COP9 signalosome complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=CSN2 PE=1 SV=1
16	P61201	1.5	33.5	443	0.063	0.063	CSN2_HUMAN COP9 signalosome complex subunit 2 OS=Homo sapiens OX=9606 GN=COPS2 PE=1 SV=1
17	P61202	1.5	33.5	443	0.063	0.063	CSN2_MOUSE COP9 signalosome complex subunit 2 OS=Mus musculus OX=10090 GN=Cops2 PE=1 SV=1
18	P61203	1.5	33.5	443	0.063	0.063	CSN2_RAT COP9 signalosome complex subunit 2 OS=Rattus norvegicus OX=10116 GN=Cops2 PE=1 SV=1
19	Q93015	1.5	33.5	286	0.088	0.136	NAA80_HUMAN N-alpha-acetyltransferase 80 OS=Homo sapiens OX=9606 GN=NAA80 PE=1 SV=2
20	Q386U6	3.5	32.3	334	0.040	0.054	Q386U6_TRYB2 Proteasome regulatory non-ATP-ase subunit 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.18.0013 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10075 CSN8_PSD8_EIF3K	31	16.0	CSN8/PSMD8/EIF3K family
2	PF09440 eIF3_N	3.2e-42	155.5	eIF3 subunit 6 N terminal domain
3	PF13286 HD_assoc	1.5e+02	14.3	Phosphohydrolase-associated domain
4	PF02877 PARP_reg	1.7e+02	13.7	Poly(ADP-ribose) polymerase, regulatory domain
5	PF01399 PCI	1.6e-16	72.1	PCI domain
6	PF19963 VMAP-M1	2.4e+02	13.7	vWA-MoxR associated protein middle region (VMAP-M) 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9778.XP_004370748.1

Rank	PPI partner	STRING score	Description
1	9778.XP_004369670.1	0.999	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF- 2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joi [...]
2	9778.XP_004369819.1	0.999	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF- 2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joi [...]
3	9778.XP_004372060.1	0.999	Eukaryotic translation initiation factor 3 subunit I
4	9778.XP_004373019.1	0.999	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF- 2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joi [...]
5	9778.XP_004373903.1	0.999	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF- 2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joi [...]
6	9778.XP_004374083.1	0.999	Eukaryotic translation initiation factor 3 subunit D
7	9778.XP_004374945.1	0.999	Eukaryotic translation initiation factor 3 subunit A
8	9778.XP_004378613.1	0.999	Eukaryotic translation initiation factor 3 subunit G
9	9778.XP_004380761.1	0.999	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF- 2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joi [...]
10	9778.XP_004385981.1	0.999	Eukaryotic translation initiation factor 3 subunit B
11	9778.XP_004388196.1	0.999	Eukaryotic translation initiation factor 3 subunit K
12	9778.XP_004371020.1	0.992	Eukaryotic translation initiation factor 2 subunit 1
13	9778.XP_004382030.1	0.988	Belongs to the universal ribosomal protein uS3 family.
14	9778.XP_004382893.1	0.986	Eukaryotic translation initiation factor 1A, X-chromosomal
15	9778.XP_004370484.1	0.978	Eukaryotic translation initiation factor 2 subunit 2
16	9778.XP_004373224.1	0.977	Belongs to the universal ribosomal protein uS5 family.
17	9778.XP_004377367.1	0.976	Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA- precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis. Also acts as a receptor for several other ligands, including the pathogenic prion protein, viruses, and bacteria. Acts as a PPP1R16B-depe [...]
18	9778.XP_004388804.1	0.976	40S ribosomal protein S19
19	9778.XP_004382914.1	0.975	Eukaryotic translation initiation factor 2 subunit 3
20	9778.XP_004371869.1	0.973	Belongs to the eukaryotic ribosomal protein eS8 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003743	1.000	translation initiation factor activity
GO:0003723	0.995	RNA binding
GO:0045296	0.825	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.990	cellular metabolic process
GO:0044238	0.989	primary metabolic process
GO:0043170	0.989	macromolecule metabolic process
GO:1901564	0.987	organonitrogen compound metabolic process
GO:0006413	0.945	translational initiation
GO:0065007	0.761	biological regulation
GO:0050789	0.676	regulation of biological process
GO:0050794	0.636	regulation of cellular process
GO:0048518	0.389	positive regulation of biological process
GO:0019222	0.348	regulation of metabolic process
GO:0060255	0.338	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.999	protein-containing complex
GO:0043226	0.947	organelle
GO:0005852	0.881	eukaryotic translation initiation factor 3 complex
GO:0043229	0.862	intracellular organelle
GO:0043232	0.788	intracellular non-membrane-bounded organelle
GO:0043231	0.678	intracellular membrane-bounded organelle
GO:0030054	0.535	cell junction
GO:0005634	0.470	nucleus
GO:0070013	0.377	intracellular organelle lumen
GO:0005654	0.361	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]