StarFunc result for job id P60323

User Input

>input (173 residues)
MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPMLEPDQKRSLESSPAPERLCSF
CKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATRERAHTRRFCPLTGQGYTSVY
SHTTRNSAGKKLVRPDKAKTQDTGHRRGGGGGAGFRGAGKSEPSPSCSPSMST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P60323	1.000	1.000	6.335E-32	173	1.000	1.000	P60323.pdb.gz	NANO3_HUMAN Nanos homolog 3 OS=Homo sapiens OX=9606 GN=NANOS3 PE=1 SV=1
2	AFDB:P60324	0.494	0.483	9.771E-22	178	0.757	0.736	P60324.pdb.gz	NANO3_MOUSE Nanos homolog 3 OS=Mus musculus OX=10090 GN=Nanos3 PE=1 SV=1
3	AFDB:P60322	0.436	0.538	3.056E-13	136	0.335	0.426	P60322.pdb.gz	NANO2_MOUSE Nanos homolog 2 OS=Mus musculus OX=10090 GN=Nanos2 PE=1 SV=2
4	AFDB:Q4QRE8	0.357	0.387	2.726E-12	159	0.329	0.358	Q4QRE8.pdb.gz
5	AFDB:P60321	0.447	0.547	3.347E-12	138	0.376	0.471	P60321.pdb.gz	NANO2_HUMAN Nanos homolog 2 OS=Homo sapiens OX=9606 GN=NANOS2 PE=1 SV=1
6	AFDB:A7XBY3	0.363	0.314	8.332E-11	201	0.347	0.299	A7XBY3.pdb.gz	A7XBY3_ORYLA NANOS3 OS=Oryzias latipes OX=8090 GN=nanos3 PE=2 SV=1
7	AFDB:Q07937	0.340	0.451	1.376E-9	128	0.266	0.359	Q07937.pdb.gz	NANO1_XENLA Nanos homolog 1 OS=Xenopus laevis OX=8355 GN=nanos1 PE=1 SV=1
8	AFDB:E7FDB3	0.353	0.271	9.339E-9	228	0.254	0.193	E7FDB3.pdb.gz	NANO1_DANRE Nanos homolog 1 OS=Danio rerio OX=7955 GN=nanos1 PE=3 SV=1
9	AFDB:Q80WY3	0.343	0.223	5.528E-8	267	0.329	0.213	Q80WY3.pdb.gz	NANO1_MOUSE Nanos homolog 1 OS=Mus musculus OX=10090 GN=Nanos1 PE=2 SV=2
10	AFDB:Q8WY41	0.353	0.211	1.256E-7	292	0.220	0.130	Q8WY41.pdb.gz	NANO1_HUMAN Nanos homolog 1 OS=Homo sapiens OX=9606 GN=NANOS1 PE=1 SV=2
11	PDB:7nfxy	0.082	0.095	4.233	147	0.075	0.088	7nfxy.pdb.gz	Receptor compaction and GTPase rearrangement drive SRP-mediated cotranslational protein translocation into the ER.
12	PDB:7btbX	0.082	0.093	5.960	141	0.069	0.085	7btbX.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
13	PDB:4lygB	0.072	0.043	6.381	310	0.040	0.023	4lygB.pdb.gz
14	PDB:7k0mA	0.096	0.045	7.317	464	0.069	0.026	7k0mA.pdb.gz	Structural insights into the regulation of human serine palmitoyltransferase complexes.
15	PDB:7rron	0.082	0.102	9.619	118	0.058	0.085	7rron.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P60323	3.10e-127	356	173	1.000	1.000	NANO3_HUMAN Nanos homolog 3 OS=Homo sapiens OX=9606 GN=NANOS3 PE=1 SV=1
2	P60324	5.23e-86	252	178	0.757	0.736	NANO3_MOUSE Nanos homolog 3 OS=Mus musculus OX=10090 GN=Nanos3 PE=1 SV=1
3	P60321	5.14e-35	121	138	0.376	0.471	NANO2_HUMAN Nanos homolog 2 OS=Homo sapiens OX=9606 GN=NANOS2 PE=1 SV=1
4	Q90WW1	1.19e-32	115	159	0.335	0.365	NANO3_DANRE Nanos homolog 3 OS=Danio rerio OX=7955 GN=nanos3 PE=1 SV=1
5	P60322	1.85e-31	112	136	0.347	0.441	NANO2_MOUSE Nanos homolog 2 OS=Mus musculus OX=10090 GN=Nanos2 PE=1 SV=2
6	A7XBY3	2.15e-25	98.6	201	0.254	0.219	A7XBY3_ORYLA NANOS3 OS=Oryzias latipes OX=8090 GN=nanos3 PE=2 SV=1
7	Q07937	6.47e-21	85.1	128	0.283	0.383	NANO1_XENLA Nanos homolog 1 OS=Xenopus laevis OX=8355 GN=nanos1 PE=1 SV=1
8	Q80WY3	2.47e-17	79.0	267	0.214	0.139	NANO1_MOUSE Nanos homolog 1 OS=Mus musculus OX=10090 GN=Nanos1 PE=2 SV=2
9	Q8WY41	1.17e-16	77.4	292	0.173	0.103	NANO1_HUMAN Nanos homolog 1 OS=Homo sapiens OX=9606 GN=NANOS1 PE=1 SV=2
10	E7FDB3	5.55e-16	74.7	228	0.173	0.132	NANO1_DANRE Nanos homolog 1 OS=Danio rerio OX=7955 GN=nanos1 PE=3 SV=1
11	A5Y5A4	1.37e-15	73.2	214	0.191	0.154	A5Y5A4_SCHMD Nanos-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1
12	P25724	8.81e-15	73.2	401	0.168	0.072	NANOS_DROME Protein nanos OS=Drosophila melanogaster OX=7227 GN=nanos PE=1 SV=1
13	Q09597	0.012	37.7	311	0.133	0.074	Q09597_CAEEL Nanos-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nos-1 PE=3 SV=1
14	Q80ZI2	0.23	33.5	223	0.139	0.108	RTP2_MOUSE Receptor-transporting protein 2 OS=Mus musculus OX=10090 GN=Rtp2 PE=1 SV=1
15	O18218	1.0	32.0	867	0.092	0.018	O18218_CAEEL Nanos-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nos-3 PE=1 SV=2
16	O62486	1.1	32.0	871	0.092	0.018	O62486_CAEEL Nanos-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nos-3 PE=1 SV=1
17	Q5QGT7	1.8	30.8	225	0.127	0.098	RTP2_HUMAN Receptor-transporting protein 2 OS=Homo sapiens OX=9606 GN=RTP2 PE=1 SV=1
18	Q96RN1	1.9	31.2	970	0.064	0.011	S26A8_HUMAN Testis anion transporter 1 OS=Homo sapiens OX=9606 GN=SLC26A8 PE=1 SV=1
19	A4Q9F0	2.0	31.2	912	0.098	0.019	TTLL7_MOUSE Tubulin polyglutamylase TTLL7 OS=Mus musculus OX=10090 GN=Ttll7 PE=1 SV=1
20	P59025	4.1	30.0	263	0.110	0.072	RTP1_HUMAN Receptor-transporting protein 1 OS=Homo sapiens OX=9606 GN=RTP1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08792 A2L_zn_ribbon	15	16.7	A2L zinc ribbon domain
2	PF15843 DUF4719	3.3e+02	12.4	Domain of unknown function (DUF4719)
3	PF16588 zf-C2H2_10	8.2e+02	11.2	C2H2 zinc-finger
4	PF05741 zf-nanos	7.6e-22	88.6	Nanos RNA binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341992

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000445366	0.899	Dead end protein homolog 1
2	9606.ENSP00000250863	0.894	Deleted in azoospermia-like
3	9606.ENSP00000338173	0.854	Pumilio homolog 2
4	9606.ENSP00000276594	0.822	PR domain zinc finger protein 14
5	9606.ENSP00000245255	0.805	Piwi-like protein 1
6	9606.ENSP00000347444	0.801	Tudor domain-containing protein 7
7	9606.ENSP00000391723	0.741	Pumilio homolog 1
8	9606.ENSP00000275764	0.730	Stimulated by retinoic acid gene 8 protein homolog
9	9606.ENSP00000358092	0.714	PR domain zinc finger protein 1
10	9606.ENSP00000424838	0.714	Probable ATP-dependent RNA helicase DDX4
11	9606.ENSP00000201031	0.667	Transcription factor AP-2 gamma
12	9606.ENSP00000293695	0.665	Synaptonemal complex central element protein 2
13	9606.ENSP00000347924	0.665	Sideroflexin-4
14	9606.ENSP00000327832	0.662	Alpha-tubulin N-acetyltransferase 1
15	9606.ENSP00000374332	0.661	Translin
16	9606.ENSP00000371711	0.654	Doublesex- and mab-3-related transcription factor 1
17	9606.ENSP00000321179	0.650	RNA-binding protein 44
18	9606.ENSP00000349208	0.635	Piwi-like protein 2
19	9606.ENSP00000364855	0.624	MutS protein homolog 5
20	9606.ENSP00000299001	0.621	Piwi-like protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.966	nucleic acid binding
GO:0003723	0.748	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0032501	0.986	multicellular organismal process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0010468	0.984	regulation of gene expression
GO:0032502	0.976	developmental process
GO:0003006	0.972	developmental process involved in reproduction
GO:0048519	0.971	negative regulation of biological process
GO:0048523	0.959	negative regulation of cellular process
GO:0048609	0.955	multicellular organismal reproductive process
GO:0007276	0.953	gamete generation
GO:0048856	0.948	anatomical structure development
GO:0031326	0.942	regulation of cellular biosynthetic process
GO:0010556	0.941	regulation of macromolecule biosynthetic process
GO:0080090	0.936	regulation of primary metabolic process
GO:0051171	0.936	regulation of nitrogen compound metabolic process
GO:0010608	0.933	post-transcriptional regulation of gene expression
GO:0034248	0.929	regulation of amide metabolic process
GO:0006417	0.920	regulation of translation
GO:0048518	0.913	positive regulation of biological process
GO:0048522	0.901	positive regulation of cellular process
GO:0007281	0.896	germ cell development
GO:0051173	0.876	positive regulation of nitrogen compound metabolic process
GO:0010604	0.875	positive regulation of macromolecule metabolic process
GO:0051252	0.875	regulation of RNA metabolic process
GO:0031325	0.866	positive regulation of cellular metabolic process
GO:0010605	0.828	negative regulation of macromolecule metabolic process
GO:0045935	0.820	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.803	positive regulation of RNA metabolic process
GO:0043488	0.781	regulation of mRNA stability
GO:0061014	0.660	positive regulation of mRNA catabolic process
GO:0051172	0.654	negative regulation of nitrogen compound metabolic process
GO:0010558	0.649	negative regulation of macromolecule biosynthetic process
GO:0031327	0.648	negative regulation of cellular biosynthetic process
GO:0017148	0.616	negative regulation of translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0048471	0.989	perinuclear region of cytoplasm
GO:0043232	0.782	intracellular non-membrane-bounded organelle
GO:0035770	0.665	ribonucleoprotein granule
GO:0036464	0.621	cytoplasmic ribonucleoprotein granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]