StarFunc result for job id P60510

User Input

>input (307 residues)
MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFY
DLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQI
TQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTI
DRKQEVPHDGPMCDLLWSDPEDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQL
VMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKK
PVADYFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8WGP3	0.978	0.965	2.131E-64	311	0.948	0.936	A8WGP3.pdb.gz	PP4CA_DANRE Serine/threonine-protein phosphatase 4 catalytic subunit A OS=Danio rerio OX=7955 GN=ppp4ca PE=2 SV=1
2	AFDB:O76932	0.981	0.981	1.037E-62	307	0.915	0.915	O76932.pdb.gz	PP4C_DROME Serine/threonine-protein phosphatase 4 catalytic subunit OS=Drosophila melanogaster OX=7227 GN=Pp4-19C PE=2 SV=1
3	AFDB:Q9Y0B7	0.985	0.991	3.361E-61	305	0.827	0.833	Q9Y0B7.pdb.gz	PP4C_DICDI Serine/threonine-protein phosphatase 4 catalytic subunit OS=Dictyostelium discoideum OX=44689 GN=ppp4c PE=1 SV=1
4	AFDB:P48528	0.980	0.986	5.214E-59	305	0.818	0.823	P48528.pdb.gz	PPX2_ARATH Serine/threonine-protein phosphatase PP-X isozyme 2 OS=Arabidopsis thaliana OX=3702 GN=PPX2 PE=2 SV=2
5	AFDB:Q9XW79	0.975	0.899	3.199E-57	333	0.801	0.739	Q9XW79.pdb.gz	PP4C1_CAEEL Serine/threonine-protein phosphatase 4 catalytic subunit 1 OS=Caenorhabditis elegans OX=6239 GN=pph-4.1 PE=1 SV=1
6	AFDB:O04951	0.973	0.973	3.363E-54	307	0.645	0.645	O04951.pdb.gz	PP2A5_ARATH Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=PP2A5 PE=1 SV=1
7	AFDB:A0A1D8PSJ8	0.969	0.972	2.150E-53	306	0.635	0.637	A0A1D8PSJ8.pdb.gz	A0A1D8PSJ8_CANAL Serine/threonine-protein phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PPH3 PE=3 SV=1
8	AFDB:B3KUN1	0.969	0.963	7.700E-53	309	0.658	0.654	B3KUN1.pdb.gz	B3KUN1_HUMAN Serine/threonine-protein phosphatase OS=Homo sapiens OX=9606 GN=PPP2CA PE=1 SV=1
9	AFDB:Q9XZE5	0.977	0.980	9.162E-53	306	0.642	0.644	Q9XZE5.pdb.gz	PP2AA_DICDI Serine/threonine-protein phosphatase 2A catalytic subunit A OS=Dictyostelium discoideum OX=44689 GN=pho2a PE=1 SV=1
10	AFDB:G5EGK8	0.968	0.935	1.375E-52	318	0.642	0.619	G5EGK8.pdb.gz	PP2A_CAEEL Serine/threonine-protein phosphatase 2A catalytic subunit OS=Caenorhabditis elegans OX=6239 GN=let-92 PE=1 SV=1
11	PDB:2nppC	0.938	0.935	8.009E-49	308	0.658	0.656	2nppC.pdb.gz	Structure of the protein phosphatase 2A holoenzyme
12	PDB:6zejI	0.900	0.789	1.285E-37	351	0.446	0.390	6zejI.pdb.gz	Molecular basis for substrate specificity of the Phactr1/PP1 phosphatase holoenzyme.
13	PDB:1s70A	0.900	0.894	5.804E-37	309	0.453	0.450	1s70A.pdb.gz	Structural basis of protein phosphatase 1 regulation
14	PDB:4il1A	0.881	0.517	1.432E-34	529	0.394	0.229	4il1A.pdb.gz	Structural basis of calcineurin activation by calmodulin.
15	PDB:7obeA	0.882	0.570	2.557E-34	480	0.375	0.240	7obeA.pdb.gz	Conformational Change of Tetratricopeptide Repeats Region Triggers Activation of Phytochrome-Associated Protein Phosphatase 5.
16	PDB:1wao1	0.870	0.573	2.871E-34	471	0.371	0.242	1wao1.pdb.gz	Molecular Basis for Tpr Domain-Mediated Regulation of Protein Phosphatase 5
17	PDB:4or9A	0.893	0.691	3.224E-34	399	0.394	0.303	4or9A.pdb.gz	Cooperative autoinhibition and multi-level activation mechanisms of calcineurin
18	PDB:1g5bB	0.468	0.626	5.816E-9	221	0.150	0.208	1g5bB.pdb.gz	Structure of the bacteriophage lambda Ser/Thr protein phosphatase with sulfate ion bound in two coordination modes.
19	PDB:5vjvA	0.433	0.444	1.638E-5	298	0.150	0.154	5vjvA.pdb.gz	Structural basis for the preference of the Arabidopsis thalianaphosphatase RLPH2 for tyrosine-phosphorylated substrates.
20	PDB:3ib7A	0.371	0.383	1.247E-4	295	0.114	0.119	3ib7A.pdb.gz	A mycobacterial cyclic AMP phosphodiesterase that moonlights as a modifier of cell wall permeability

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R625	0.0	639	307	1.000	1.000	A0A024R625_HUMAN Serine/threonine-protein phosphatase OS=Homo sapiens OX=9606 GN=PPP4C PE=2 SV=1
2	A6H772	0.0	639	307	1.000	1.000	PP4C_BOVIN Serine/threonine-protein phosphatase 4 catalytic subunit OS=Bos taurus OX=9913 GN=PPP4C PE=1 SV=1
3	A8WGP3	0.0	616	311	0.951	0.939	PP4CA_DANRE Serine/threonine-protein phosphatase 4 catalytic subunit A OS=Danio rerio OX=7955 GN=ppp4ca PE=2 SV=1
4	A9JRC7	0.0	630	307	0.980	0.980	PP4CB_DANRE Serine/threonine-protein phosphatase 4 catalytic subunit B OS=Danio rerio OX=7955 GN=ppp4cb PE=2 SV=1
5	H3BTA2	0.0	541	267	0.870	1.000	H3BTA2_HUMAN Serine/threonine-protein phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=PPP4C PE=1 SV=1
6	O76932	0.0	598	307	0.915	0.915	PP4C_DROME Serine/threonine-protein phosphatase 4 catalytic subunit OS=Drosophila melanogaster OX=7227 GN=Pp4-19C PE=2 SV=1
7	P48528	0.0	541	305	0.818	0.823	PPX2_ARATH Serine/threonine-protein phosphatase PP-X isozyme 2 OS=Arabidopsis thaliana OX=3702 GN=PPX2 PE=2 SV=2
8	P48529	0.0	525	305	0.795	0.800	PPX1_ARATH Serine/threonine-protein phosphatase PP-X isozyme 1 OS=Arabidopsis thaliana OX=3702 GN=PPX1 PE=1 SV=1
9	P60510	0.0	639	307	1.000	1.000	PP4C_HUMAN Serine/threonine-protein phosphatase 4 catalytic subunit OS=Homo sapiens OX=9606 GN=PPP4C PE=1 SV=1
10	P97470	0.0	639	307	1.000	1.000	PP4C_MOUSE Serine/threonine-protein phosphatase 4 catalytic subunit OS=Mus musculus OX=10090 GN=Ppp4c PE=1 SV=2
11	Q5BJ92	0.0	637	307	0.997	0.997	PP4C_RAT Serine/threonine-protein phosphatase 4 catalytic subunit OS=Rattus norvegicus OX=10116 GN=Ppp4c PE=2 SV=1
12	Q9XW79	0.0	536	333	0.801	0.739	PP4C1_CAEEL Serine/threonine-protein phosphatase 4 catalytic subunit 1 OS=Caenorhabditis elegans OX=6239 GN=pph-4.1 PE=1 SV=1
13	Q9Y0B7	0.0	554	305	0.827	0.833	PP4C_DICDI Serine/threonine-protein phosphatase 4 catalytic subunit OS=Dictyostelium discoideum OX=44689 GN=ppp4c PE=1 SV=1
14	O74789	1.49e-161	455	348	0.707	0.624	YOU5_SCHPO Putative serine/threonine-protein phosphatase C26H8.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC26H8.05c PE=1 SV=1
15	Q07098	5.09e-158	445	306	0.658	0.660	PP2A2_ARATH Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=PP2A2 PE=1 SV=1
16	Q07099	1.95e-156	441	306	0.658	0.660	PP2A1_ARATH Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=PP2A1 PE=1 SV=1
17	Q0P594	2.70e-156	441	309	0.658	0.654	PP2AB_BOVIN Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Bos taurus OX=9913 GN=PPP2CB PE=1 SV=1
18	A0A1D8PSJ8	3.52e-156	440	306	0.635	0.637	A0A1D8PSJ8_CANAL Serine/threonine-protein phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PPH3 PE=3 SV=1
19	P62714	1.37e-155	439	309	0.655	0.650	PP2AB_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP2CB PE=1 SV=1
20	P62715	1.37e-155	439	309	0.655	0.650	PP2AB_MOUSE Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Mus musculus OX=10090 GN=Ppp2cb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03636 Glyco_hydro_65N	7.7e+02	11.1	Glycosyl hydrolase family 65, N-terminal domain
2	PF00149 Metallophos	1.3e-36	138.6	Calcineurin-like phosphoesterase
3	PF16891 STPPase_N	1.5	20.6	Serine-threonine protein phosphatase N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008822137.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008832929.1	0.996	Serine/threonine-protein phosphatase 4 regulatory subunit 1
2	1026970.XP_008829809.1	0.995	Protein phosphatase 4 regulatory subunit 2
3	1026970.XP_008819957.1	0.991	Serine/threonine-protein phosphatase 4 regulatory subunit 3A isoform X1
4	1026970.XP_008840969.1	0.982	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 2 codons
5	1026970.XP_008824212.1	0.978	Protein phosphatase 2 phosphatase activator
6	1026970.XP_008821222.1	0.975	Protein phosphatase 4 regulatory subunit 3B
7	1026970.XP_008824721.1	0.975	Serine/threonine-protein phosphatase 4 regulatory subunit 3B-like
8	1026970.XP_008845654.1	0.972	Protein phosphatase 2 scaffold subunit Aalpha
9	1026970.XP_008826112.1	0.963	Protein phosphatase 2 catalytic subunit alpha
10	1026970.XP_008847421.1	0.960	Leucine carboxyl methyltransferase 1
11	1026970.XP_008831023.1	0.952	Protein phosphatase 2 scaffold subunit Abeta
12	1026970.XP_008832053.1	0.949	Protein phosphatase 3 regulatory subunit B, alpha
13	1026970.XP_008843163.1	0.946	Protein phosphatase 2 catalytic subunit beta
14	1026970.XP_008831586.1	0.936	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins, and 17% coverage of the annotated genomic feature by RNAseq alignments
15	1026970.XP_008842606.1	0.936	Immunoglobulin-binding protein 1
16	1026970.XP_008839444.1	0.935	Serine/threonine-protein phosphatase 1 regulatory subunit 10
17	1026970.XP_008824383.1	0.924	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform isoform X1
18	1026970.XP_008849431.1	0.923	Serine/threonine-protein phosphatase 4 regulatory subunit 4
19	1026970.XP_008851271.1	0.921	Protein phosphatase 2 regulatory subunit B''beta
20	1026970.XP_008820965.1	0.914	Putative SMEK homolog 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004722	1.000	protein serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.989	cellular metabolic process
GO:0071704	0.980	organic substance metabolic process
GO:0050789	0.976	regulation of biological process
GO:0043170	0.964	macromolecule metabolic process
GO:0050794	0.930	regulation of cellular process
GO:0044238	0.885	primary metabolic process
GO:0006807	0.857	nitrogen compound metabolic process
GO:0006793	0.765	phosphorus metabolic process
GO:0050896	0.543	response to stimulus
GO:0048518	0.470	positive regulation of biological process
GO:0019222	0.469	regulation of metabolic process
GO:0060255	0.437	regulation of macromolecule metabolic process
GO:0080090	0.430	regulation of primary metabolic process
GO:0031323	0.430	regulation of cellular metabolic process
GO:0019538	0.427	protein metabolic process
GO:0048519	0.424	negative regulation of biological process
GO:0051171	0.420	regulation of nitrogen compound metabolic process
GO:0048522	0.415	positive regulation of cellular process
GO:0051716	0.400	cellular response to stimulus
GO:0048523	0.395	negative regulation of cellular process
GO:0043412	0.387	macromolecule modification
GO:0032501	0.374	multicellular organismal process
GO:0032502	0.356	developmental process
GO:0048856	0.354	anatomical structure development
GO:0071840	0.339	cellular component organization or biogenesis
GO:0006796	0.337	phosphate-containing compound metabolic process
GO:0036211	0.330	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.999	nucleus
GO:0005829	0.965	cytosol
GO:0032991	0.957	protein-containing complex
GO:1902494	0.911	catalytic complex
GO:0070013	0.906	intracellular organelle lumen
GO:0031981	0.893	nuclear lumen
GO:1903293	0.851	phosphatase complex
GO:0005654	0.848	nucleoplasm
GO:0008287	0.782	protein serine/threonine phosphatase complex
GO:0043228	0.765	non-membrane-bounded organelle
GO:0043232	0.687	intracellular non-membrane-bounded organelle
GO:0016020	0.622	membrane
GO:0071944	0.361	cell periphery
GO:0005886	0.313	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]