StarFunc result for job id P60568

User Input

>input (153 residues)
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13169	0.844	0.828	1.062E-20	156	0.987	0.968	Q13169.pdb.gz	Q13169_HUMAN Interleukin-2 OS=Homo sapiens OX=9606 GN=IL2 PE=2 SV=1
2	AFDB:P17108	0.823	0.813	7.621E-15	155	0.601	0.594	P17108.pdb.gz	IL2_RAT Interleukin-2 OS=Rattus norvegicus OX=10116 GN=Il2 PE=2 SV=1
3	PDB:7ra9A	0.769	0.928	3.905E-14	126	0.699	0.849	7ra9A.pdb.gz
4	PDB:4nemA	0.723	0.964	1.716E-13	114	0.739	0.991	4nemA.pdb.gz	Small molecular fragments bound to binding energy hot-spot in crystal contact interface of Interleukin-2
5	PDB:1irlA	0.683	0.769	1.914E-13	133	0.863	0.992	1irlA.pdb.gz
6	AFDB:P04351	0.783	0.711	4.911E-13	169	0.621	0.562	P04351.pdb.gz	IL2_MOUSE Interleukin-2 OS=Mus musculus OX=10090 GN=Il2 PE=1 SV=1
7	PDB:3qb1G	0.710	0.973	1.623E-12	111	0.686	0.946	3qb1G.pdb.gz
8	AFDB:O42288	0.588	0.622	2.398E-3	143	0.190	0.203	O42288.pdb.gz	O42288_CHICK Interleukin OS=Gallus gallus OX=9031 GN=IL2 PE=2 SV=1
9	AFDB:Q9HBE4	0.384	0.367	1.633E-2	162	0.190	0.179	Q9HBE4.pdb.gz	IL21_HUMAN Interleukin-21 OS=Homo sapiens OX=9606 GN=IL21 PE=1 SV=3
10	AFDB:F1CFE1	0.505	0.570	2.985E-2	133	0.124	0.143	F1CFE1.pdb.gz	F1CFE1_PIG Interleukin-4 OS=Sus scrofa OX=9823 GN=IL-4 PE=2 SV=1
11	AFDB:Q1JQ34	0.407	0.333	3.926E-2	210	0.137	0.100	Q1JQ34.pdb.gz	Q1JQ34_DANRE Growth hormone 1 OS=Danio rerio OX=7955 GN=ghl PE=2 SV=1
12	AFDB:E7FKY2	0.368	0.382	5.454E-2	145	0.137	0.145	E7FKY2.pdb.gz	E7FKY2_ONCMY Interleukin 4/13A OS=Oncorhynchus mykiss OX=8022 GN=IL4/13A PE=2 SV=1
13	AFDB:P0DML2	0.381	0.296	6.429E-2	217	0.203	0.143	P0DML2.pdb.gz	CSH1_HUMAN Chorionic somatomammotropin hormone 1 OS=Homo sapiens OX=9606 GN=CSH1 PE=1 SV=1
14	AFDB:P01241	0.370	0.292	8.457E-2	217	0.190	0.134	P01241.pdb.gz	SOMA_HUMAN Somatotropin OS=Homo sapiens OX=9606 GN=GH1 PE=1 SV=2
15	PDB:1huwA	0.420	0.394	1.616E-1	166	0.131	0.120	1huwA.pdb.gz
16	PDB:2oqpA	0.357	0.398	1.803E-1	134	0.150	0.172	2oqpA.pdb.gz
17	PDB:2gmfA	0.421	0.494	6.021E-1	121	0.092	0.116	2gmfA.pdb.gz
18	PDB:3duhC	0.295	0.312	6.021E-1	137	0.118	0.131	3duhC.pdb.gz
19	PDB:3piwA	0.256	0.255	7.497E-1	154	0.118	0.117	3piwA.pdb.gz
20	PDB:1f6fA	0.407	0.348	9.861E-1	183	0.144	0.120	1f6fA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P60568	3.13e-110	311	153	1.000	1.000	IL2_HUMAN Interleukin-2 OS=Homo sapiens OX=9606 GN=IL2 PE=1 SV=1
2	Q13169	4.41e-106	301	156	0.987	0.968	Q13169_HUMAN Interleukin-2 OS=Homo sapiens OX=9606 GN=IL2 PE=2 SV=1
3	P17108	3.64e-59	182	155	0.667	0.658	IL2_RAT Interleukin-2 OS=Rattus norvegicus OX=10116 GN=Il2 PE=2 SV=1
4	P04351	3.61e-56	175	169	0.621	0.562	IL2_MOUSE Interleukin-2 OS=Mus musculus OX=10090 GN=Il2 PE=1 SV=1
5	Q9VNW6	1.6	31.2	776	0.118	0.023	Q9VNW6_DROME Delta-1-pyrroline-5-carboxylate synthase OS=Drosophila melanogaster OX=7227 GN=P5CS PE=1 SV=1
6	Q582H4	1.9	31.2	1645	0.150	0.014	Q582H4_TRYB2 Protein NO VEIN C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.420 PE=4 SV=1
7	Q38AG6	2.1	30.8	441	0.072	0.025	Q38AG6_TRYB2 AAA+ ATPase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2570 PE=4 SV=1
8	P55163	5.3	29.6	1141	0.229	0.031	GEX3_CAEEL Membrane-associated protein gex-3 OS=Caenorhabditis elegans OX=6239 GN=gex-3 PE=1 SV=2
9	O43312	6.4	29.3	755	0.131	0.026	MTSS1_HUMAN Protein MTSS 1 OS=Homo sapiens OX=9606 GN=MTSS1 PE=1 SV=2
10	Q8R1S4	7.0	29.3	759	0.131	0.026	MTSS1_MOUSE Protein MTSS 1 OS=Mus musculus OX=10090 GN=Mtss1 PE=1 SV=1
11	P08617	8.9	28.9	2227	0.131	0.009	POLG_HAVHM Genome polyprotein OS=Human hepatitis A virus genotype IB (isolate HM175) OX=12098 PE=1 SV=1
12	Q01992	9.9	28.9	710	0.131	0.028	MIPEP_RAT Mitochondrial intermediate peptidase OS=Rattus norvegicus OX=10116 GN=Mipep PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00715 IL2	9e-75	260.9	Interleukin 2
2	PF09686 Plasmid_RAQPRD	6.9	18.3	Plasmid protein of unknown function (Plasmid_RAQPRD)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000226730

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216223	0.999	Interleukin-2 receptor subunit beta
2	9606.ENSP00000363318	0.999	Cytokine receptor common subunit gamma
3	9606.ENSP00000369293	0.999	Interleukin-2 receptor subunit alpha
4	9606.ENSP00000365380	0.998	Forkhead box protein P3
5	9606.ENSP00000391676	0.995	Tyrosine-protein kinase JAK3
6	9606.ENSP00000293328	0.994	Signal transducer and activator of transcription 5B
7	9606.ENSP00000386559	0.991	T-cell surface glycoprotein CD8 alpha chain
8	9606.ENSP00000280357	0.985	Interleukin-18
9	9606.ENSP00000341208	0.983	Signal transducer and activator of transcription 5A
10	9606.ENSP00000343204	0.983	Tyrosine-protein kinase JAK1
11	9606.ENSP00000379330	0.980	Nuclear factor of activated T-cells, cytoplasmic 2
12	9606.ENSP00000337825	0.974	Tyrosine-protein kinase Lck
13	9606.ENSP00000384273	0.972	Transcription factor p65
14	9606.ENSP00000264657	0.970	Signal transducer and activator of transcription 3
15	9606.ENSP00000354782	0.970	T-cell surface glycoprotein CD3 zeta chain
16	9606.ENSP00000360266	0.969	Transcription factor AP-1
17	9606.ENSP00000354394	0.968	Signal transducer and activator of transcription 1-alpha/beta
18	9606.ENSP00000451828	0.966	RAC-alpha serine/threonine-protein kinase
19	9606.ENSP00000379873	0.963	HLA class I histocompatibility antigen, A-3 alpha chain
20	9606.ENSP00000354566	0.961	T-cell surface glycoprotein CD3 epsilon chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019209	1.000	kinase activator activity
GO:0005134	1.000	interleukin-2 receptor binding
GO:0005125	1.000	cytokine activity
GO:0008083	0.675	growth factor activity
GO:0003824	0.426	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.979	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0050896	0.969	response to stimulus
GO:0048522	0.969	positive regulation of cellular process
GO:0010604	0.968	positive regulation of macromolecule metabolic process
GO:0007154	0.966	cell communication
GO:0023052	0.963	signaling
GO:0080090	0.961	regulation of primary metabolic process
GO:0031323	0.961	regulation of cellular metabolic process
GO:0051171	0.957	regulation of nitrogen compound metabolic process
GO:0032501	0.946	multicellular organismal process
GO:0051246	0.941	regulation of protein metabolic process
GO:0002376	0.938	immune system process
GO:0042110	0.934	T cell activation
GO:0022407	0.926	regulation of cell-cell adhesion
GO:0045785	0.926	positive regulation of cell adhesion
GO:1903708	0.922	positive regulation of hemopoiesis
GO:0048519	0.921	negative regulation of biological process
GO:1903131	0.913	mononuclear cell differentiation
GO:0032946	0.910	positive regulation of mononuclear cell proliferation
GO:0050670	0.909	regulation of lymphocyte proliferation
GO:0051174	0.905	regulation of phosphorus metabolic process
GO:0048523	0.902	negative regulation of cellular process
GO:0042325	0.898	regulation of phosphorylation
GO:0010468	0.892	regulation of gene expression
GO:0010941	0.890	regulation of cell death
GO:1903037	0.883	regulation of leukocyte cell-cell adhesion
GO:0031325	0.882	positive regulation of cellular metabolic process
GO:0010628	0.882	positive regulation of gene expression
GO:0051247	0.877	positive regulation of protein metabolic process
GO:0031399	0.876	regulation of protein modification process
GO:0051716	0.873	cellular response to stimulus
GO:0043067	0.873	regulation of programmed cell death
GO:0001932	0.869	regulation of protein phosphorylation
GO:0050863	0.864	regulation of T cell activation
GO:0042981	0.863	regulation of apoptotic process
GO:0007165	0.855	signal transduction
GO:0006955	0.853	immune response
GO:1903039	0.848	positive regulation of leukocyte cell-cell adhesion
GO:0043066	0.843	negative regulation of apoptotic process
GO:0050671	0.840	positive regulation of lymphocyte proliferation
GO:0048583	0.838	regulation of response to stimulus
GO:0030307	0.838	positive regulation of cell growth
GO:1902107	0.835	positive regulation of leukocyte differentiation
GO:0050870	0.801	positive regulation of T cell activation
GO:0030098	0.768	lymphocyte differentiation
GO:0030217	0.740	T cell differentiation
GO:0007267	0.737	cell-cell signaling
GO:0030101	0.720	natural killer cell activation
GO:0001817	0.685	regulation of cytokine production
GO:0048584	0.676	positive regulation of response to stimulus
GO:0050730	0.650	regulation of peptidyl-tyrosine phosphorylation
GO:0050776	0.643	regulation of immune response
GO:0031401	0.642	positive regulation of protein modification process
GO:0080134	0.638	regulation of response to stress
GO:0010562	0.625	positive regulation of phosphorus metabolic process
GO:0032101	0.613	regulation of response to external stimulus
GO:0045619	0.551	regulation of lymphocyte differentiation
GO:0042327	0.520	positive regulation of phosphorylation
GO:0001819	0.492	positive regulation of cytokine production
GO:0001934	0.468	positive regulation of protein phosphorylation
GO:0031347	0.465	regulation of defense response
GO:0007166	0.382	cell surface receptor signaling pathway
GO:0042221	0.365	response to chemical
GO:0042129	0.340	regulation of T cell proliferation
GO:0042102	0.331	positive regulation of T cell proliferation
GO:0009966	0.325	regulation of signal transduction
GO:0008152	0.323	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.997	extracellular region
GO:0071944	0.860	cell periphery
GO:0005615	0.858	extracellular space
GO:0005886	0.817	plasma membrane
GO:0005622	0.763	intracellular anatomical structure
GO:0005737	0.610	cytoplasm
GO:0043231	0.487	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]