StarFunc result for job id P60660

User Input

>input (151 residues)
MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM
NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM
TEEEVEMLVAGHEDSNGCINYEAFVRHILSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P60660	1.000	1.000	2.758E-28	151	1.000	1.000	P60660.pdb.gz	MYL6_HUMAN Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 PE=1 SV=2
2	AFDB:P02607	0.998	0.998	7.227E-27	151	0.894	0.894	P02607.pdb.gz	MYL6_CHICK Myosin light polypeptide 6 OS=Gallus gallus OX=9031 GN=MYL6 PE=1 SV=3
3	AFDB:P14649	0.990	0.720	2.539E-23	208	0.801	0.582	P14649.pdb.gz	MYL6B_HUMAN Myosin light chain 6B OS=Homo sapiens OX=9606 GN=MYL6B PE=1 SV=1
4	AFDB:B0R0F7	0.993	0.766	4.048E-23	196	0.722	0.556	B0R0F7.pdb.gz
5	AFDB:P05976	0.993	0.774	4.291E-23	194	0.728	0.567	P05976.pdb.gz	MYL1_HUMAN Myosin light chain 1/3, skeletal muscle isoform OS=Homo sapiens OX=9606 GN=MYL1 PE=1 SV=3
6	AFDB:P12829	0.994	0.763	5.419E-23	197	0.775	0.594	P12829.pdb.gz	MYL4_HUMAN Myosin light chain 4 OS=Homo sapiens OX=9606 GN=MYL4 PE=1 SV=3
7	AFDB:P02604	0.989	0.779	6.089E-23	192	0.728	0.573	P02604.pdb.gz	MLE1_CHICK Myosin light chain 1, skeletal muscle isoform OS=Gallus gallus OX=9031 PE=1 SV=3
8	AFDB:P16409	0.992	0.750	1.378E-22	200	0.742	0.560	P16409.pdb.gz	MYL3_RAT Myosin light chain 3 OS=Rattus norvegicus OX=10116 GN=Myl3 PE=1 SV=2
9	AFDB:A0A060VX90	0.992	0.806	1.124E-21	186	0.642	0.522	A0A060VX90.pdb.gz	A0A060VX90_ONCMY Myosin, light chain 13 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00067106001 PE=4 SV=1
10	AFDB:Q90WC7	0.988	0.775	2.264E-21	193	0.636	0.497	Q90WC7.pdb.gz	Q90WC7_ONCMY Myosin light chain 1 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
11	PDB:6z47C	0.874	0.880	7.331E-18	150	0.887	0.893	6z47C.pdb.gz	Structure of the shutdown state of myosin-2.
12	PDB:5tbyC	0.898	0.893	1.709E-16	152	0.728	0.724	5tbyC.pdb.gz
13	PDB:3wfnB	0.450	0.404	1.668E-11	169	0.444	0.396	3wfnB.pdb.gz
14	PDB:1m46A	0.442	0.449	8.536E-11	148	0.338	0.345	1m46A.pdb.gz	Two distinct myosin light chain structures are induced by specific variations within the bound IQ motifs-functional implications
15	PDB:1ggzA	0.316	0.328	3.566E-9	144	0.464	0.486	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
16	PDB:1a2xA	0.429	0.411	4.773E-9	158	0.318	0.304	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
17	PDB:1osaA	0.321	0.326	6.027E-9	148	0.430	0.439	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
18	PDB:5a2hA	0.329	0.336	7.179E-9	147	0.430	0.442	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
19	PDB:2f2pA	0.329	0.302	8.067E-9	169	0.430	0.385	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
20	PDB:2lmtA	0.438	0.446	1.445E-8	148	0.384	0.392	2lmtA.pdb.gz	Structure of androcam supports specialized interactions with myosin VI.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P60660	8.78e-111	312	151	1.000	1.000	MYL6_HUMAN Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 PE=1 SV=2
2	P60661	8.78e-111	312	151	1.000	1.000	MYL6_BOVIN Myosin light polypeptide 6 OS=Bos taurus OX=9913 GN=MYL6 PE=2 SV=2
3	P60662	8.78e-111	312	151	1.000	1.000	MYL6_PIG Myosin light polypeptide 6 OS=Sus scrofa OX=9823 GN=MYL6 PE=1 SV=2
4	Q60605	8.78e-111	312	151	1.000	1.000	MYL6_MOUSE Myosin light polypeptide 6 OS=Mus musculus OX=10090 GN=Myl6 PE=1 SV=3
5	Q64119	3.03e-106	301	151	0.960	0.960	MYL6_RAT Myosin light polypeptide 6 OS=Rattus norvegicus OX=10116 GN=Myl6 PE=1 SV=3
6	Q6W5H0	2.49e-100	286	151	0.894	0.894	Q6W5H0_MELGA Myosin light chain smooth muscle isoform OS=Meleagris gallopavo OX=9103 PE=1 SV=1
7	P02607	3.86e-100	285	151	0.894	0.894	MYL6_CHICK Myosin light polypeptide 6 OS=Gallus gallus OX=9031 GN=MYL6 PE=1 SV=3
8	P14649	1.78e-89	261	208	0.801	0.582	MYL6B_HUMAN Myosin light chain 6B OS=Homo sapiens OX=9606 GN=MYL6B PE=1 SV=1
9	Q8CI43	3.78e-89	260	207	0.788	0.575	MYL6B_MOUSE Myosin light chain 6B OS=Mus musculus OX=10090 GN=Myl6b PE=1 SV=1
10	P12829	6.29e-84	246	197	0.775	0.594	MYL4_HUMAN Myosin light chain 4 OS=Homo sapiens OX=9606 GN=MYL4 PE=1 SV=3
11	P16409	3.62e-81	239	200	0.742	0.560	MYL3_RAT Myosin light chain 3 OS=Rattus norvegicus OX=10116 GN=Myl3 PE=1 SV=2
12	P05976	4.59e-81	239	194	0.728	0.567	MYL1_HUMAN Myosin light chain 1/3, skeletal muscle isoform OS=Homo sapiens OX=9606 GN=MYL1 PE=1 SV=3
13	P02600	6.01e-80	236	189	0.728	0.582	MYL1_RAT Myosin light chain 1/3, skeletal muscle isoform OS=Rattus norvegicus OX=10116 GN=Myl1 PE=1 SV=2
14	P08590	2.47e-79	234	195	0.728	0.564	MYL3_HUMAN Myosin light chain 3 OS=Homo sapiens OX=9606 GN=MYL3 PE=1 SV=3
15	Q5XJC3	4.41e-78	231	196	0.722	0.556	Q5XJC3_DANRE Cardiac myosin light chain-1 OS=Danio rerio OX=7955 GN=cmlc1 PE=2 SV=1
16	P02604	1.18e-76	228	192	0.728	0.573	MLE1_CHICK Myosin light chain 1, skeletal muscle isoform OS=Gallus gallus OX=9031 PE=1 SV=3
17	Q6P0G6	1.32e-72	217	190	0.656	0.521	MYL1_DANRE Myosin, light chain 1, alkali; skeletal, fast OS=Danio rerio OX=7955 GN=myl1 PE=2 SV=1
18	A0A060Z1U0	2.83e-71	216	258	0.682	0.399	A0A060Z1U0_ONCMY EF-hand domain-containing protein (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00018997001 PE=4 SV=1
19	A0A060WZI6	3.12e-70	211	186	0.649	0.527	A0A060WZI6_ONCMY Myosin, light chain 13 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00007606001 PE=4 SV=1
20	A0A060VX90	6.54e-69	208	186	0.642	0.522	A0A060VX90_ONCMY Myosin, light chain 13 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00067106001 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	2.9e-08	43.8	EF hand
2	PF13202 EF-hand_5	13	16.6	EF hand
3	PF13405 EF-hand_6	2.8e-05	34.6	EF-hand domain
4	PF13499 EF-hand_7	0.00033	32.4	EF-hand domain pair
5	PF13833 EF-hand_8	1.1	20.4	EF-hand domain pair
6	PF14658 EF-hand_9	3.1	19.6	EF-hand domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 51337.XP_004650030.1

Rank	PPI partner	STRING score	Description
1	51337.XP_004663205.1	0.964	Upstream in-frame stop codon
2	51337.XP_004650327.1	0.959	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 mRNAs, 17 Proteins
3	51337.XP_004661688.1	0.950	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 36 Proteins
4	51337.XP_004662709.1	0.950	Myosin regulatory light chain 12B isoform X1
5	51337.XP_004672605.1	0.922	Myosin-14 isoform X1
6	51337.XP_004652107.1	0.918	Myosin-11
7	51337.XP_004663889.1	0.912	Myosin light chain kinase, smooth muscle
8	51337.XP_004653573.1	0.899	Myosin light chain 1/3, skeletal muscle isoform isoform X1
9	51337.XP_004666719.1	0.876	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 54 Proteins
10	51337.XP_004664844.1	0.856	Myosin light chain kinase 3
11	51337.XP_004671029.1	0.850	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform isoform X1
12	51337.XP_004666196.1	0.826	Uncharacterized protein LOC101610366
13	51337.XP_004650192.1	0.816	Upstream in-frame stop codon
14	51337.XP_004671028.1	0.808	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 7 Proteins
15	51337.XP_004656808.1	0.803	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit isoform X1
16	51337.XP_004666342.1	0.795	Myosin regulatory light chain 10 isoform X1
17	51337.XP_004662708.1	0.792	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 45 Proteins
18	51337.XP_004673245.1	0.792	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: inserted 1 base in 1 codon
19	51337.XP_004655321.1	0.785	Actin, cytoplasmic 2
20	51337.XP_004663189.1	0.785	Myosin-13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003774	0.999	cytoskeletal motor activity
GO:0008307	0.999	structural constituent of muscle
GO:0005515	0.999	protein binding
GO:0008092	0.698	cytoskeletal protein binding
GO:0043167	0.562	ion binding
GO:0046872	0.426	metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0003012	0.992	muscle system process
GO:0030048	0.985	actin filament-based movement
GO:0070252	0.984	actin-mediated cell contraction
GO:0048856	0.948	anatomical structure development
GO:0006936	0.946	muscle contraction
GO:0061061	0.939	muscle structure development
GO:0007517	0.925	muscle organ development
GO:0060537	0.832	muscle tissue development
GO:0060538	0.804	skeletal muscle organ development
GO:0065007	0.586	biological regulation
GO:0050789	0.488	regulation of biological process
GO:0050794	0.471	regulation of cellular process
GO:0007519	0.452	skeletal muscle tissue development
GO:0071840	0.345	cellular component organization or biogenesis
GO:0016043	0.317	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0032991	0.977	protein-containing complex
GO:0005856	0.970	cytoskeleton
GO:0015629	0.962	actin cytoskeleton
GO:0043227	0.873	membrane-bounded organelle
GO:0016459	0.857	myosin complex
GO:0043231	0.766	intracellular membrane-bounded organelle
GO:0016461	0.695	unconventional myosin complex
GO:0016020	0.660	membrane
GO:0070062	0.620	extracellular exosome
GO:0099512	0.508	supramolecular fiber
GO:0043292	0.491	contractile fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]