StarFunc result for job id P60673

User Input

>input (137 residues)
MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRHTFL
QAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGI
LNKTVHELIRGLRMQGA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9DAD6	0.989	0.989	3.367E-25	137	0.883	0.883	Q9DAD6.pdb.gz	PROF3_MOUSE Profilin-3 OS=Mus musculus OX=10090 GN=Pfn3 PE=1 SV=1
2	AFDB:P07737	0.951	0.931	2.462E-16	140	0.431	0.421	P07737.pdb.gz	PROF1_HUMAN Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2
3	PDB:3chwP	0.948	0.935	1.626E-15	139	0.423	0.417	3chwP.pdb.gz	Modulation of actin structure and function by phosphorylation of Tyr-53 and profilin binding.
4	AFDB:P35080	0.948	0.928	2.347E-15	140	0.409	0.400	P35080.pdb.gz	PROF2_HUMAN Profilin-2 OS=Homo sapiens OX=9606 GN=PFN2 PE=1 SV=3
5	PDB:2vk3A	0.933	0.901	8.562E-15	142	0.409	0.394	2vk3A.pdb.gz
6	AFDB:E7F0A1	0.931	0.906	3.636E-13	141	0.299	0.291	E7F0A1.pdb.gz	E7F0A1_DANRE Profilin OS=Danio rerio OX=7955 GN=fa91a03 PE=1 SV=1
7	PDB:3d9yA	0.753	0.813	4.881E-7	126	0.241	0.262	3d9yA.pdb.gz
8	PDB:6b6jA	0.730	0.735	5.180E-7	136	0.241	0.243	6b6jA.pdb.gz
9	AFDB:Q9D6I3	0.742	0.782	5.896E-7	129	0.168	0.178	Q9D6I3.pdb.gz	PROF4_MOUSE Profilin-4 OS=Mus musculus OX=10090 GN=Pfn4 PE=1 SV=1
10	PDB:1k0kA	0.731	0.791	6.189E-7	125	0.234	0.256	1k0kA.pdb.gz
11	AFDB:P39825	0.750	0.803	9.478E-7	127	0.255	0.276	P39825.pdb.gz	PROF_SCHPO Profilin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc3 PE=1 SV=1
12	PDB:5fefA	0.774	0.801	9.948E-7	132	0.263	0.273	5fefA.pdb.gz
13	AFDB:Q21193	0.699	0.753	1.067E-6	126	0.190	0.206	Q21193.pdb.gz	PROF3_CAEEL Profilin-3 OS=Caenorhabditis elegans OX=6239 GN=pfn-3 PE=2 SV=1
14	PDB:7sbdC	0.702	0.711	1.120E-6	135	0.241	0.244	7sbdC.pdb.gz
15	AFDB:P07274	0.757	0.816	1.202E-6	126	0.190	0.206	P07274.pdb.gz	PROF_YEAST Profilin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFY1 PE=1 SV=2
16	AFDB:P25843	0.763	0.823	1.820E-6	126	0.212	0.230	P25843.pdb.gz	PROF_DROME Profilin OS=Drosophila melanogaster OX=7227 GN=chic PE=1 SV=1
17	AFDB:P68696	0.752	0.810	1.820E-6	126	0.190	0.206	P68696.pdb.gz	PRO1A_ACACA Profilin-1A OS=Acanthamoeba castellanii OX=5755 PE=1 SV=2
18	PDB:1prqA	0.737	0.800	2.283E-6	125	0.190	0.208	1prqA.pdb.gz
19	PDB:1a0kA	0.717	0.751	4.385E-6	130	0.234	0.246	1a0kA.pdb.gz
20	PDB:6iqjB	0.778	0.811	5.899E-6	131	0.212	0.221	6iqjB.pdb.gz	Structural and computational examination of theArabidopsisprofilin-Poly-P complex reveals mechanistic details in profilin-regulated actin assembly.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9DAD6	5.81e-83	241	137	0.883	0.883	PROF3_MOUSE Profilin-3 OS=Mus musculus OX=10090 GN=Pfn3 PE=1 SV=1
2	P62962	5.76e-37	125	140	0.438	0.429	PROF1_MOUSE Profilin-1 OS=Mus musculus OX=10090 GN=Pfn1 PE=1 SV=2
3	P62963	5.76e-37	125	140	0.438	0.429	PROF1_RAT Profilin-1 OS=Rattus norvegicus OX=10116 GN=Pfn1 PE=1 SV=2
4	P07737	4.34e-36	122	140	0.438	0.429	PROF1_HUMAN Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2
5	Q9EPC6	1.37e-33	116	140	0.423	0.414	PROF2_RAT Profilin-2 OS=Rattus norvegicus OX=10116 GN=Pfn2 PE=1 SV=3
6	Q9JJV2	6.43e-33	114	140	0.416	0.407	PROF2_MOUSE Profilin-2 OS=Mus musculus OX=10090 GN=Pfn2 PE=1 SV=3
7	P35080	7.58e-33	114	140	0.416	0.407	PROF2_HUMAN Profilin-2 OS=Homo sapiens OX=9606 GN=PFN2 PE=1 SV=3
8	E7F0A1	3.11e-21	85.1	141	0.307	0.298	E7F0A1_DANRE Profilin OS=Danio rerio OX=7955 GN=fa91a03 PE=1 SV=1
9	Q93243	2.9	30.0	765	0.146	0.026	NAS37_CAEEL Zinc metalloproteinase nas-37 OS=Caenorhabditis elegans OX=6239 GN=nas-37 PE=1 SV=2
10	U5PZT6	3.4	29.6	591	0.095	0.022	TPS8_HEDCO Monoterpene synthase 8, chloroplastic OS=Hedychium coronarium OX=71610 GN=TPS8 PE=1 SV=1
11	P07314	3.7	29.6	568	0.139	0.033	GGT1_RAT Glutathione hydrolase 1 proenzyme OS=Rattus norvegicus OX=10116 GN=Ggt1 PE=1 SV=4
12	Q60928	6.7	28.9	568	0.109	0.026	GGT1_MOUSE Glutathione hydrolase 1 proenzyme OS=Mus musculus OX=10090 GN=Ggt1 PE=1 SV=1
13	P36268	7.4	28.9	569	0.102	0.025	GGT2_HUMAN Inactive glutathione hydrolase 2 OS=Homo sapiens OX=9606 GN=GGT2P PE=1 SV=3
14	Q9UL17	7.4	28.9	535	0.124	0.032	TBX21_HUMAN T-box transcription factor TBX21 OS=Homo sapiens OX=9606 GN=TBX21 PE=1 SV=1
15	P19440	9.7	28.5	569	0.102	0.025	GGT1_HUMAN Glutathione hydrolase 1 proenzyme OS=Homo sapiens OX=9606 GN=GGT1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00235 Profilin	3.8e-15	67.6	Profilin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351379

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000322170	0.977	Profilin-4
2	9606.ENSP00000333037	0.881	Actin related protein T3
3	9606.ENSP00000321348	0.838	Protein diaphanous homolog 2
4	9606.ENSP00000349960	0.823	Actin, cytoplasmic 1
5	9606.ENSP00000458162	0.823	Actin, cytoplasmic 2
6	9606.ENSP00000381565	0.821	Protein diaphanous homolog 1
7	9606.ENSP00000225655	0.810	Profilin-1
8	9606.ENSP00000365411	0.803	Amyloid beta A4 precursor protein-binding family B member 1-interacting protein
9	9606.ENSP00000211998	0.800	Vinculin
10	9606.ENSP00000321424	0.795	Sodium-dependent phosphate transport protein 2A
11	9606.ENSP00000265299	0.558	Probable ubiquitin carboxyl-terminal hydrolase MINDY-4
12	9606.ENSP00000377797	0.557	Ubiquitin carboxyl-terminal hydrolase 49
13	9606.ENSP00000360165	0.554	Negatively regulates the Hedgehog (SHH) signaling. Binds to the promoter of the SHH signaling mediator, GLI1, and inhibits its expression
14	9606.ENSP00000316674	0.537	Actin-like protein 9
15	9606.ENSP00000326238	0.534	F-actin-capping protein subunit alpha-3
16	9606.ENSP00000297001	0.512	Spermatogenesis-associated protein 48
17	9606.ENSP00000386604	0.510	Uncharacterized protein C7orf31
18	9606.ENSP00000362054	0.508	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	0.997	actin binding
GO:0035091	0.503	phosphatidylinositol binding
GO:0043168	0.469	anion binding
GO:0003785	0.391	actin monomer binding
GO:1901981	0.350	phosphatidylinositol phosphate binding
GO:0005546	0.335	phosphatidylinositol-4,5-bisphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0016043	0.969	cellular component organization
GO:0048522	0.920	positive regulation of cellular process
GO:0051128	0.869	regulation of cellular component organization
GO:0044087	0.772	regulation of cellular component biogenesis
GO:0033043	0.693	regulation of organelle organization
GO:0065008	0.691	regulation of biological quality
GO:0032501	0.560	multicellular organismal process
GO:0051493	0.503	regulation of cytoskeleton organization
GO:0051179	0.435	localization
GO:0032956	0.434	regulation of actin cytoskeleton organization
GO:1902903	0.430	regulation of supramolecular fiber organization
GO:0048523	0.410	negative regulation of cellular process
GO:0110053	0.393	regulation of actin filament organization
GO:0019222	0.384	regulation of metabolic process
GO:0050896	0.354	response to stimulus
GO:0032502	0.314	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0043229	0.980	intracellular organelle
GO:0043231	0.959	intracellular membrane-bounded organelle
GO:0005576	0.949	extracellular region
GO:0043228	0.942	non-membrane-bounded organelle
GO:0005829	0.942	cytosol
GO:0031982	0.929	vesicle
GO:0043232	0.924	intracellular non-membrane-bounded organelle
GO:0070062	0.915	extracellular exosome
GO:0005856	0.910	cytoskeleton
GO:0016020	0.877	membrane
GO:0032991	0.809	protein-containing complex
GO:0005634	0.796	nucleus
GO:0070013	0.774	intracellular organelle lumen
GO:0030054	0.709	cell junction
GO:0071944	0.636	cell periphery
GO:0031981	0.590	nuclear lumen
GO:0005654	0.463	nucleoplasm
GO:0005886	0.450	plasma membrane
GO:0005925	0.426	focal adhesion
GO:0031410	0.362	cytoplasmic vesicle
GO:0042995	0.326	cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]