StarFunc result for job id P60842

User Input

>input (406 residues)
MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQ
RAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVV
MALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFV
LDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEE
LTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVS
AMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRI
GRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P60842	1.000	1.000	6.832E-77	406	1.000	1.000	P60842.pdb.gz	IF4A1_HUMAN Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1
2	AFDB:A6M930	0.958	0.956	4.052E-69	407	0.899	0.897	A6M930.pdb.gz	A6M930_PIG ATP-dependent RNA helicase OS=Sus scrofa OX=9823 GN=EIF4A2 PE=1 SV=1
3	AFDB:Q02748	0.964	0.971	1.383E-61	403	0.719	0.725	Q02748.pdb.gz	IF4A_DROME Eukaryotic initiation factor 4A OS=Drosophila melanogaster OX=7227 GN=eIF4A PE=1 SV=3
4	PDB:7pq0B	0.544	0.573	7.218E-61	385	0.938	0.990	7pq0B.pdb.gz
5	AFDB:P47943	0.943	0.976	2.189E-60	392	0.719	0.745	P47943.pdb.gz	IF4A_SCHPO ATP-dependent RNA helicase eIF4A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif1 PE=1 SV=2
6	AFDB:Q8IKF0	0.958	0.977	8.538E-58	398	0.670	0.683	Q8IKF0.pdb.gz	Q8IKF0_PLAF7 RNA helicase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1468700 PE=3 SV=1
7	AFDB:I1GWP1	0.926	0.908	8.689E-57	414	0.692	0.679	I1GWP1.pdb.gz	I1GWP1_BRADI ATP-dependent RNA helicase OS=Brachypodium distachyon OX=15368 GN=100844546 PE=3 SV=1
8	AFDB:Q9VHS8	0.923	0.939	8.689E-57	399	0.670	0.682	Q9VHS8.pdb.gz	IF4A3_DROME Eukaryotic initiation factor 4A-III OS=Drosophila melanogaster OX=7227 GN=CG7483 PE=1 SV=1
9	AFDB:Q6FQQ6	0.930	0.954	1.145E-56	396	0.633	0.649	Q6FQQ6.pdb.gz	IF4A_CANGA ATP-dependent RNA helicase eIF4A OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=TIF1 PE=3 SV=1
10	AFDB:P10081	0.931	0.957	2.103E-56	395	0.638	0.656	P10081.pdb.gz	IF4A_YEAST ATP-dependent RNA helicase eIF4A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIF1 PE=1 SV=3
11	AFDB:Q94A52	0.943	0.938	2.929E-56	408	0.611	0.608	Q94A52.pdb.gz	RH2_ARATH Eukaryotic initiation factor 4A-III homolog OS=Arabidopsis thaliana OX=3702 GN=EIF4A3 PE=1 SV=2
12	PDB:3ex7C	0.910	0.942	1.244E-51	392	0.660	0.684	3ex7C.pdb.gz	Mechanism of ATP turnover inhibition in the EJC
13	PDB:1fuuB	0.525	0.561	4.030E-47	380	0.621	0.663	1fuuB.pdb.gz
14	PDB:2j0uB	0.482	0.562	8.514E-39	347	0.586	0.686	2j0uB.pdb.gz	The Crystal Structure of the Exon Junction Complex Reveals How It Mantains a Stable Grip on Mrna
15	PDB:2zu6F	0.400	0.549	1.498E-31	271	0.655	0.982	2zu6F.pdb.gz
16	PDB:7pliA	0.871	0.775	1.583E-31	457	0.298	0.265	7pliA.pdb.gz	Structural basis for RNA-duplex unwinding by the DEAD-box helicase DbpA.
17	PDB:1xtkA	0.527	0.551	5.139E-30	382	0.340	0.361	1xtkA.pdb.gz
18	PDB:7v2yF	0.584	0.619	3.181E-29	376	0.320	0.346	7v2yF.pdb.gz
19	PDB:7evoE	0.503	0.451	1.863E-28	455	0.283	0.253	7evoE.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
20	PDB:7evnE	0.501	0.421	3.294E-27	486	0.268	0.224	7evnE.pdb.gz	Mechanisms of the RNA helicases DDX42 and DDX46 in human U2 snRNP assembly.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A6M930	740	407	0.897	0.894	A6M930_PIG ATP-dependent RNA helicase OS=Sus scrofa OX=9823 GN=EIF4A2 PE=1 SV=1
2	F4JEL4	545	415	0.643	0.629	F4JEL4_ARATH Eukaryotic translation initiation factor 4A1 OS=Arabidopsis thaliana OX=3702 GN=EIF4A1 PE=1 SV=1
3	I1GWP1	589	414	0.695	0.681	I1GWP1_BRADI ATP-dependent RNA helicase OS=Brachypodium distachyon OX=15368 GN=100844546 PE=3 SV=1
4	I3L3H2	517	390	0.633	0.659	I3L3H2_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=2
5	O44781	550	399	0.631	0.642	O44781_CAEEL RNA helicase OS=Caenorhabditis elegans OX=6239 GN=CELE_F33D11.10 PE=1 SV=1
6	P10630	740	407	0.897	0.894	IF4A2_MOUSE Eukaryotic initiation factor 4A-II OS=Mus musculus OX=10090 GN=Eif4a2 PE=1 SV=2
7	P38919	561	411	0.667	0.659	IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4
8	P41376	575	412	0.675	0.665	IF4A1_ARATH Eukaryotic initiation factor 4A-1 OS=Arabidopsis thaliana OX=3702 GN=EIF4A1 PE=1 SV=1
9	P41377	575	412	0.677	0.667	IF4A2_ARATH Eukaryotic initiation factor 4A-2 OS=Arabidopsis thaliana OX=3702 GN=TIF4A-2 PE=1 SV=1
10	P47943	586	392	0.719	0.745	IF4A_SCHPO ATP-dependent RNA helicase eIF4A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif1 PE=1 SV=2
11	P60842	841	406	1.000	1.000	IF4A1_HUMAN Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1
12	P60843	841	406	1.000	1.000	IF4A1_MOUSE Eukaryotic initiation factor 4A-I OS=Mus musculus OX=10090 GN=Eif4a1 PE=1 SV=1
13	Q02748	595	403	0.719	0.725	IF4A_DROME Eukaryotic initiation factor 4A OS=Drosophila melanogaster OX=7227 GN=eIF4A PE=1 SV=3
14	Q10055	549	394	0.631	0.650	FAL1_SCHPO ATP-dependent RNA helicase fal1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif412 PE=1 SV=1
15	Q14240	740	407	0.897	0.894	IF4A2_HUMAN Eukaryotic initiation factor 4A-II OS=Homo sapiens OX=9606 GN=EIF4A2 PE=1 SV=2
16	Q3B8Q2	561	411	0.667	0.659	IF4A3_RAT Eukaryotic initiation factor 4A-III OS=Rattus norvegicus OX=10116 GN=Eif4a3 PE=1 SV=1
17	Q6Z2Z4	587	414	0.687	0.674	IF4A3_ORYSJ Eukaryotic initiation factor 4A-3 OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0146600 PE=1 SV=1
18	Q8IKF0	561	398	0.667	0.681	Q8IKF0_PLAF7 RNA helicase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1468700 PE=3 SV=1
19	Q91VC3	561	411	0.665	0.657	IF4A3_MOUSE Eukaryotic initiation factor 4A-III OS=Mus musculus OX=10090 GN=Eif4a3 PE=1 SV=3
20	Q94A52	524	408	0.606	0.603	RH2_ARATH Eukaryotic initiation factor 4A-III homolog OS=Arabidopsis thaliana OX=3702 GN=EIF4A3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13245 AAA_19	0.48	22.1	AAA domain
2	PF13401 AAA_22	4.5e+02	12.5	AAA domain
3	PF13604 AAA_30	7.2	17.8	AAA domain
4	PF00270 DEAD	7.1e-41	151.4	DEAD/DEAH box helicase
5	PF07652 Flavi_DEAD	1.3e+02	14.0	Flavivirus DEAD domain
6	PF00271 Helicase_C	2.8e-28	109.8	Helicase conserved C-terminal domain
7	PF05127 Helicase_RecD	1.6e+02	13.5	Helicase
8	PF04851 ResIII	0.0013	30.2	Type III restriction enzyme, res subunit
9	PF00580 UvrD-helicase	4e+02	11.9	UvrD/REP helicase N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008854023.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008829510.1	0.999	Eukaryotic translation initiation factor 4 gamma 1 isoform X1
2	1026970.XP_008843841.1	0.997	Programmed cell death protein 4 isoform X1
3	1026970.XP_008851768.1	0.997	Eukaryotic translation initiation factor 4 gamma 2
4	1026970.XP_008824401.1	0.995	Eukaryotic translation initiation factor 4E
5	1026970.XP_008836569.1	0.995	Eukaryotic translation initiation factor 4B
6	1026970.XP_008836836.1	0.993	Eukaryotic translation initiation factor 4 gamma 3
7	1026970.XP_008849626.1	0.990	Eukaryotic translation initiation factor 3 subunit B
8	1026970.XP_008846216.1	0.986	Eukaryotic translation initiation factor 3 subunit I
9	1026970.XP_008831147.1	0.985	Polyadenylate-binding protein-interacting protein 1 isoform X1
10	1026970.XP_008825541.1	0.982	Eukaryotic translation initiation factor 3 subunit A
11	1026970.XP_008821865.1	0.978	Eukaryotic initiation factor 4A-II isoform X1
12	1026970.XP_008849727.1	0.976	Eukaryotic translation initiation factor 3 subunit E
13	1026970.XP_008850369.1	0.971	Eukaryotic translation initiation factor 2 subunit 1
14	1026970.XP_008849696.1	0.967	Eukaryotic translation initiation factor 3 subunit M
15	1026970.XP_008836181.1	0.965	Eukaryotic translation initiation factor 3 subunit H
16	1026970.XP_008849559.1	0.965	Eukaryotic translation initiation factor 3 subunit D
17	1026970.XP_008843755.1	0.955	Ribosomal protein S6
18	1026970.XP_008833467.1	0.952	Eukaryotic translation initiation factor 1
19	1026970.XP_008853271.1	0.946	Eukaryotic translation initiation factor 2 subunit beta
20	1026970.XP_008829782.1	0.929	Polyadenylate-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.996	nucleic acid binding
GO:0003723	0.983	RNA binding
GO:0004386	0.896	helicase activity
GO:0008186	0.848	ATP-dependent activity, acting on RNA
GO:0045182	0.479	translation regulator activity
GO:0140098	0.468	catalytic activity, acting on RNA
GO:0003729	0.454	mRNA binding
GO:0008135	0.425	translation factor activity, RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050789	0.975	regulation of biological process
GO:0050794	0.830	regulation of cellular process
GO:0019222	0.807	regulation of metabolic process
GO:0008152	0.723	metabolic process
GO:0006807	0.685	nitrogen compound metabolic process
GO:0044237	0.682	cellular metabolic process
GO:0071704	0.678	organic substance metabolic process
GO:0044238	0.655	primary metabolic process
GO:0043170	0.595	macromolecule metabolic process
GO:0060255	0.522	regulation of macromolecule metabolic process
GO:0051171	0.482	regulation of nitrogen compound metabolic process
GO:0080090	0.480	regulation of primary metabolic process
GO:0050896	0.458	response to stimulus
GO:0010468	0.458	regulation of gene expression
GO:0034641	0.449	cellular nitrogen compound metabolic process
GO:0031323	0.449	regulation of cellular metabolic process
GO:0048519	0.437	negative regulation of biological process
GO:0048518	0.424	positive regulation of biological process
GO:0010467	0.357	gene expression
GO:0048522	0.328	positive regulation of cellular process
GO:0032502	0.323	developmental process
GO:0009889	0.315	regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043226	0.990	organelle
GO:0032991	0.984	protein-containing complex
GO:0005829	0.984	cytosol
GO:0043227	0.980	membrane-bounded organelle
GO:0043229	0.975	intracellular organelle
GO:0043231	0.915	intracellular membrane-bounded organelle
GO:0005634	0.835	nucleus
GO:0031981	0.562	nuclear lumen
GO:0043232	0.400	intracellular non-membrane-bounded organelle
GO:0016281	0.303	eukaryotic translation initiation factor 4F complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]