StarFunc result for job id P60891

User Input

>input (318 residues)
MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGC
GEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAG
ADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTS
IADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAG
ATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAI
RRTHNGESVSYLFSHVPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:M0RBK1	1.000	1.000	4.803E-63	318	0.953	0.953	M0RBK1.pdb.gz	M0RBK1_RAT ribose-phosphate diphosphokinase OS=Rattus norvegicus OX=10116 GN=Prps1l1 PE=3 SV=1
2	AFDB:Q9VT33	0.988	0.810	7.473E-57	388	0.874	0.716	Q9VT33.pdb.gz	Q9VT33_DROME ribose-phosphate diphosphokinase OS=Drosophila melanogaster OX=7227 GN=Prps PE=1 SV=3
3	PDB:4lygB	0.966	0.991	3.623E-56	310	0.972	0.997	4lygB.pdb.gz
4	AFDB:O94413	0.979	0.970	7.421E-51	321	0.701	0.695	O94413.pdb.gz	KPR2_SCHPO Ribose-phosphate pyrophosphokinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1620.06c PE=1 SV=1
5	AFDB:Q5BBW5	0.984	0.978	3.016E-49	320	0.670	0.666	Q5BBW5.pdb.gz	Q5BBW5_EMENI ribose-phosphate diphosphokinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01965 PE=3 SV=1
6	AFDB:P38620	0.969	0.969	3.561E-47	318	0.616	0.616	P38620.pdb.gz	KPR2_YEAST Ribose-phosphate pyrophosphokinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRS2 PE=1 SV=1
7	AFDB:P38063	0.968	0.945	3.766E-47	326	0.626	0.610	P38063.pdb.gz	KPR4_YEAST Ribose-phosphate pyrophosphokinase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRS4 PE=1 SV=3
8	AFDB:Q54PA9	0.970	0.973	6.242E-47	317	0.607	0.609	Q54PA9.pdb.gz	PRPSA_DICDI Ribose-phosphate pyrophosphokinase A OS=Dictyostelium discoideum OX=44689 GN=prsA PE=1 SV=1
9	AFDB:Q5ALK3	0.969	0.964	2.401E-46	320	0.607	0.603	Q5ALK3.pdb.gz	Q5ALK3_CANAL ribose-phosphate diphosphokinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PRS1 PE=3 SV=1
10	AFDB:P38689	0.973	0.967	6.595E-46	320	0.604	0.600	P38689.pdb.gz	KPR3_YEAST Ribose-phosphate pyrophosphokinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRS3 PE=1 SV=1
11	AFDB:Q5B8G1	0.947	0.695	2.136E-42	435	0.563	0.411	Q5B8G1.pdb.gz	Q5B8G1_EMENI Ribose-phosphate pyrophosphokinase (AFU_orthologue AFUA_3G13380) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03169 PE=3 SV=1
12	PDB:4s2uA	0.930	0.960	1.442E-36	308	0.465	0.481	4s2uA.pdb.gz	Crystal structure of the Phosphorybosylpyrophosphate synthetase from E. Coli
13	PDB:2c4kA	0.922	0.961	1.027E-34	305	0.459	0.479	2c4kA.pdb.gz
14	PDB:2ji4A	0.901	0.948	5.534E-34	302	0.462	0.487	2ji4A.pdb.gz
15	PDB:1a95B	0.237	0.415	8.868E-5	150	0.066	0.140	1a95B.pdb.gz	Structures of free and complexed forms of Escherichia coli xanthine-guanine phosphoribosyltransferase.
16	PDB:5vn4A	0.281	0.362	1.390E-4	237	0.113	0.152	5vn4A.pdb.gz	Crystal structure of adenine phosphoribosyl transferase from Trypanosoma brucei in complex with AMP, pyrophosphate, and ribose-5-phosphate
17	PDB:5knyB	0.288	0.454	5.053E-4	187	0.060	0.102	5knyB.pdb.gz	Crystal structure of Mycobacterium tuberculosis hypoxanthine guanine phosphoribosyltransferase in complex with pyrrolidine nucleoside phosphonate
18	PDB:5vjpB	0.319	0.542	5.654E-4	179	0.075	0.134	5vjpB.pdb.gz	Synthesis of bis-Phosphate Iminoaltritol Enantiomers and Structural Characterization with Adenine Phosphoribosyltransferase.
19	PDB:2ps1A	0.289	0.385	7.485E-4	224	0.075	0.107	2ps1A.pdb.gz	Ternary complex formation and induced asymmetry in orotate phosphoribosyltransferase.
20	PDB:5knxB	0.300	0.501	8.858E-4	176	0.053	0.097	5knxB.pdb.gz	Crystal Structures of Acyclic Nucleoside Phosphonates in Complex with Escherichia coli Hypoxanthine Phosphoribosyltransferase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M0RBK1	0.0	631	318	0.953	0.953	M0RBK1_RAT ribose-phosphate diphosphokinase OS=Rattus norvegicus OX=10116 GN=Prps1l1 PE=3 SV=1
2	P09330	0.0	635	318	0.959	0.959	PRPS2_RAT Ribose-phosphate pyrophosphokinase 2 OS=Rattus norvegicus OX=10116 GN=Prps2 PE=1 SV=3
3	P11908	0.0	633	318	0.953	0.953	PRPS2_HUMAN Ribose-phosphate pyrophosphokinase 2 OS=Homo sapiens OX=9606 GN=PRPS2 PE=1 SV=2
4	P60891	0.0	655	318	1.000	1.000	PRPS1_HUMAN Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1 PE=1 SV=2
5	P60892	0.0	655	318	1.000	1.000	PRPS1_RAT Ribose-phosphate pyrophosphokinase 1 OS=Rattus norvegicus OX=10116 GN=Prps1 PE=1 SV=2
6	Q9CS42	0.0	634	318	0.956	0.956	PRPS2_MOUSE Ribose-phosphate pyrophosphokinase 2 OS=Mus musculus OX=10090 GN=Prps2 PE=1 SV=4
7	Q9D7G0	0.0	655	318	1.000	1.000	PRPS1_MOUSE Ribose-phosphate pyrophosphokinase 1 OS=Mus musculus OX=10090 GN=Prps1 PE=1 SV=4
8	Q9VT33	0.0	572	388	0.881	0.722	Q9VT33_DROME ribose-phosphate diphosphokinase OS=Drosophila melanogaster OX=7227 GN=Prps PE=1 SV=3
9	O94413	8.89e-164	460	321	0.701	0.695	KPR2_SCHPO Ribose-phosphate pyrophosphokinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1620.06c PE=1 SV=1
10	Q5BBW5	1.43e-158	447	320	0.673	0.669	Q5BBW5_EMENI ribose-phosphate diphosphokinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01965 PE=3 SV=1
11	P38063	1.32e-142	407	326	0.626	0.610	KPR4_YEAST Ribose-phosphate pyrophosphokinase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRS4 PE=1 SV=3
12	P38689	9.93e-141	402	320	0.610	0.606	KPR3_YEAST Ribose-phosphate pyrophosphokinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRS3 PE=1 SV=1
13	Q5ALK3	1.44e-140	402	320	0.601	0.597	Q5ALK3_CANAL ribose-phosphate diphosphokinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PRS1 PE=3 SV=1
14	Q54PA9	2.71e-139	398	317	0.607	0.609	PRPSA_DICDI Ribose-phosphate pyrophosphokinase A OS=Dictyostelium discoideum OX=44689 GN=prsA PE=1 SV=1
15	P38620	8.86e-139	397	318	0.613	0.613	KPR2_YEAST Ribose-phosphate pyrophosphokinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRS2 PE=1 SV=1
16	P0A717	1.19e-101	303	315	0.484	0.489	KPRS_ECOLI Ribose-phosphate pyrophosphokinase OS=Escherichia coli (strain K12) OX=83333 GN=prs PE=1 SV=2
17	O64888	2.16e-91	279	394	0.434	0.350	KPRS5_ARATH Ribose-phosphate pyrophosphokinase 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PRS5 PE=2 SV=2
18	O60256	3.98e-89	273	369	0.484	0.417	KPRB_HUMAN Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Homo sapiens OX=9606 GN=PRPSAP2 PE=1 SV=1
19	O08618	8.11e-88	269	369	0.481	0.415	KPRB_RAT Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Prpsap2 PE=1 SV=1
20	Q8R574	8.47e-88	269	369	0.481	0.415	KPRB_MOUSE Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Mus musculus OX=10090 GN=Prpsap2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09861 Lar_N	4.3e+02	11.5	Lactate racemase N-terminal domain
2	PF00156 Pribosyltran	2.2e-10	51.6	Phosphoribosyl transferase domain
3	PF13793 Pribosyltran_N	1.3e-45	165.4	N-terminal domain of ribose phosphate pyrophosphokinase
4	PF14572 Pribosyl_synth	2.1e-40	150.1	Phosphoribosyl synthetase-associated domain
5	PF14681 UPRTase	1.3	20.0	Uracil phosphoribosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010610155.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010616747.1	0.871	Phosphoribosyl pyrophosphate synthase-associated protein 1
2	885580.XP_010617214.1	0.868	Phosphoribosyl pyrophosphate synthase-associated protein 2
3	885580.XP_010616534.1	0.855	Uridine 5'-monophosphate synthase
4	885580.XP_010623929.1	0.802	Ribose-5-phosphate isomerase
5	885580.XP_010603013.1	0.794	Catalyzes the phosphorylation of ribose at O-5 in a reaction requiring ATP and magnesium. The resulting D-ribose-5-phosphate can then be used either for sythesis of nucleotides, histidine, and tryptophan, or as a component of the pentose phosphate pathway.
6	885580.XP_010638596.1	0.785	In the C-terminal section
7	885580.XP_010612275.1	0.779	Ribose-phosphate pyrophosphokinase 2
8	885580.XP_010641350.1	0.753	Transketolase
9	885580.XP_010623381.1	0.740	Phosphoglucomutase-2
10	885580.XP_010628177.1	0.722	Transketolase-like protein 2
11	885580.XP_010636297.1	0.721	GDH/6PGL endoplasmic bifunctional protein
12	885580.XP_010626343.1	0.696	Transketolase-like protein 1
13	885580.XP_010637853.1	0.688	Bardet-Biedl syndrome 10 protein like protein
14	885580.XP_010605033.1	0.675	ADP-ribose pyrophosphatase, mitochondrial isoform X1
15	885580.XP_010641432.1	0.675	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
16	885580.XP_010619611.1	0.662	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
17	885580.XP_010613297.1	0.655	Uncharacterized protein
18	885580.XP_010629419.1	0.652	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
19	885580.XP_010603369.1	0.649	Belongs to the phosphohexose mutase family.
20	885580.XP_010606973.1	0.647	In the C-terminal section

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004749	1.000	ribose phosphate diphosphokinase activity
GO:0005515	0.998	protein binding
GO:0042802	0.892	identical protein binding
GO:0097159	0.677	organic cyclic compound binding
GO:1901363	0.676	heterocyclic compound binding
GO:0043167	0.437	ion binding
GO:0097367	0.303	carbohydrate derivative binding
GO:0036094	0.303	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0034641	0.996	cellular nitrogen compound metabolic process
GO:1901360	0.995	organic cyclic compound metabolic process
GO:0046483	0.995	heterocycle metabolic process
GO:0006725	0.995	cellular aromatic compound metabolic process
GO:0072521	0.991	purine-containing compound metabolic process
GO:0006753	0.985	nucleoside phosphate metabolic process
GO:0019693	0.982	ribose phosphate metabolic process
GO:0006163	0.981	purine nucleotide metabolic process
GO:0046390	0.949	ribose phosphate biosynthetic process
GO:0072524	0.832	pyridine-containing compound metabolic process
GO:0044249	0.603	cellular biosynthetic process
GO:0046496	0.565	nicotinamide nucleotide metabolic process
GO:0034654	0.428	nucleobase-containing compound biosynthetic process
GO:1901293	0.341	nucleoside phosphate biosynthetic process
GO:0009165	0.332	nucleotide biosynthetic process
GO:0009259	0.326	ribonucleotide metabolic process
GO:1901566	0.324	organonitrogen compound biosynthetic process
GO:0006739	0.307	NADP metabolic process
GO:0006091	0.306	generation of precursor metabolites and energy
GO:0009150	0.306	purine ribonucleotide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.994	cytosol
GO:0032991	0.972	protein-containing complex
GO:1902494	0.519	catalytic complex
GO:1990234	0.396	transferase complex
GO:0061695	0.317	transferase complex, transferring phosphorus-containing groups

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15609	1.000	ATP + D-ribose 5-phosphate = 5-phospho-alpha-D-ribose 1-diphosphate + AMP + H(+)
EC:2.7.6.1	1.000	ribose-phosphate diphosphokinase.

[back to server]