StarFunc result for job id P60903

User Input

>input (97 residues)
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD
QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08207	0.996	0.996	4.965E-16	97	0.918	0.918	P08207.pdb.gz	S10AA_MOUSE Protein S100-A10 OS=Mus musculus OX=10090 GN=S100a10 PE=1 SV=2
2	PDB:4hrgA	0.906	0.777	2.152E-13	114	0.959	0.816	4hrgA.pdb.gz	SMARCA3, a Chromatin-Remodeling Factor, Is Required for p11-Dependent Antidepressant Action.
3	AFDB:Q5XJJ5	0.906	0.864	3.576E-9	102	0.495	0.471	Q5XJJ5.pdb.gz	Q5XJJ5_DANRE Protein S100 OS=Danio rerio OX=7955 GN=zgc:101880 PE=2 SV=1
4	AFDB:Q8WXG8	0.904	0.887	1.392E-8	99	0.464	0.455	Q8WXG8.pdb.gz	S100Z_HUMAN Protein S100-Z OS=Homo sapiens OX=9606 GN=S100Z PE=1 SV=4
5	AFDB:A0A060WYU6	0.849	0.857	3.228E-8	96	0.433	0.438	A0A060WYU6.pdb.gz	A0A060WYU6_ONCMY Protein S100 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00052820001 PE=3 SV=1
6	AFDB:P50543	0.876	0.868	5.779E-8	98	0.381	0.378	P50543.pdb.gz	S10AB_MOUSE Protein S100-A11 OS=Mus musculus OX=10090 GN=S100a11 PE=1 SV=1
7	AFDB:P31949	0.861	0.801	9.697E-8	105	0.361	0.333	P31949.pdb.gz	S10AB_HUMAN Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2
8	PDB:2lucA	0.835	0.777	1.023E-7	105	0.361	0.333	2lucA.pdb.gz
9	AFDB:Q5T7Y6	0.819	0.551	1.256E-7	147	0.454	0.299	Q5T7Y6.pdb.gz	Q5T7Y6_HUMAN Protein S100 OS=Homo sapiens OX=9606 GN=S100A1 PE=1 SV=1
10	PDB:7psqG	0.790	0.716	3.074E-7	108	0.340	0.306	7psqG.pdb.gz	Crystal structure of S100A4 labeled with NU074381b.
11	AFDB:P05942	0.844	0.812	3.774E-7	101	0.340	0.327	P05942.pdb.gz	S10A4_RAT Protein S100-A4 OS=Rattus norvegicus OX=10116 GN=S100a4 PE=2 SV=1
12	AFDB:P25815	0.804	0.820	4.296E-7	95	0.433	0.442	P25815.pdb.gz	S100P_HUMAN Protein S100-P OS=Homo sapiens OX=9606 GN=S100P PE=1 SV=2
13	AFDB:P29034	0.842	0.834	5.216E-7	98	0.340	0.337	P29034.pdb.gz	S10A2_HUMAN Protein S100-A2 OS=Homo sapiens OX=9606 GN=S100A2 PE=1 SV=3
14	PDB:2k2fA	0.707	0.732	4.092E-6	93	0.443	0.462	2k2fA.pdb.gz	S100A1 and Calmodulin Compete for the Same Binding Site on Ryanodine Receptor.
15	PDB:5csnA	0.755	0.777	5.300E-6	94	0.351	0.362	5csnA.pdb.gz	Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
16	PDB:5hydA	0.603	0.608	7.325E-6	96	0.423	0.427	5hydA.pdb.gz
17	PDB:6zdyA	0.790	0.714	9.490E-6	108	0.299	0.269	6zdyA.pdb.gz	Divalent cations influence the dimerization mode of murine S100A9 protein by modulating its disulfide bond pattern.
18	PDB:7nmiB	0.785	0.168	9.490E-6	488	0.402	0.080	7nmiB.pdb.gz	Transactivation domain of p53 in complex with S100P using annexin A2 as a crystallization chaperone
19	PDB:2kayA	0.799	0.839	1.229E-5	92	0.309	0.326	2kayA.pdb.gz	Solution structure and dynamics of S100A5 in the apo and Ca2+-bound states
20	PDB:1k96A	0.773	0.837	1.813E-5	89	0.237	0.258	1k96A.pdb.gz	Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P60903	2.48e-68	201	97	1.000	1.000	S10AA_HUMAN Protein S100-A10 OS=Homo sapiens OX=9606 GN=S100A10 PE=1 SV=2
2	P08207	1.80e-63	189	97	0.918	0.918	S10AA_MOUSE Protein S100-A10 OS=Mus musculus OX=10090 GN=S100a10 PE=1 SV=2
3	P05943	4.54e-62	185	95	0.887	0.905	S10AA_RAT Protein S100-A10 OS=Rattus norvegicus OX=10116 GN=S100a10 PE=1 SV=2
4	Q5XJJ5	3.64e-30	105	102	0.495	0.471	Q5XJJ5_DANRE Protein S100 OS=Danio rerio OX=7955 GN=zgc:101880 PE=2 SV=1
5	Q8WXG8	7.83e-27	96.3	99	0.464	0.455	S100Z_HUMAN Protein S100-Z OS=Homo sapiens OX=9606 GN=S100Z PE=1 SV=4
6	P02639	4.30e-25	92.0	94	0.454	0.468	S10A1_BOVIN Protein S100-A1 OS=Bos taurus OX=9913 GN=S100A1 PE=1 SV=2
7	A0A0S2Z4H2	7.27e-25	91.3	94	0.454	0.468	A0A0S2Z4H2_HUMAN Protein S100 (Fragment) OS=Homo sapiens OX=9606 GN=S100A1 PE=2 SV=1
8	P23297	7.27e-25	91.3	94	0.454	0.468	S10A1_HUMAN Protein S100-A1 OS=Homo sapiens OX=9606 GN=S100A1 PE=1 SV=2
9	A0A060WZ60	1.22e-24	90.9	96	0.443	0.448	A0A060WZ60_ONCMY Protein S100 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00063160001 PE=3 SV=1
10	P35467	2.05e-24	90.1	94	0.464	0.479	S10A1_RAT Protein S100-A1 OS=Rattus norvegicus OX=10116 GN=S100a1 PE=1 SV=3
11	P56565	3.71e-24	89.4	94	0.443	0.457	S10A1_MOUSE Protein S100-A1 OS=Mus musculus OX=10090 GN=S100a1 PE=1 SV=2
12	Q5T7Y6	3.40e-23	88.6	147	0.454	0.299	Q5T7Y6_HUMAN Protein S100 OS=Homo sapiens OX=9606 GN=S100A1 PE=1 SV=1
13	P25815	9.20e-21	80.9	95	0.412	0.421	S100P_HUMAN Protein S100-P OS=Homo sapiens OX=9606 GN=S100P PE=1 SV=2
14	P50543	1.48e-19	77.8	98	0.381	0.378	S10AB_MOUSE Protein S100-A11 OS=Mus musculus OX=10090 GN=S100a11 PE=1 SV=1
15	P31949	1.49e-19	78.2	105	0.371	0.343	S10AB_HUMAN Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2
16	A0A060WYU6	3.49e-17	72.0	96	0.433	0.438	A0A060WYU6_ONCMY Protein S100 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00052820001 PE=3 SV=1
17	P26447	9.40e-16	68.2	101	0.340	0.327	S10A4_HUMAN Protein S100-A4 OS=Homo sapiens OX=9606 GN=S100A4 PE=1 SV=1
18	P05942	1.35e-15	67.8	101	0.320	0.307	S10A4_RAT Protein S100-A4 OS=Rattus norvegicus OX=10116 GN=S100a4 PE=2 SV=1
19	P07091	1.97e-15	67.4	101	0.330	0.317	S10A4_MOUSE Protein S100-A4 OS=Mus musculus OX=10090 GN=S100a4 PE=1 SV=1
20	P50114	3.51e-15	66.6	92	0.351	0.370	S100B_MOUSE Protein S100-B OS=Mus musculus OX=10090 GN=S100b PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	0.065	23.9	EF hand
2	PF13405 EF-hand_6	43	15.3	EF-hand domain
3	PF13499 EF-hand_7	0.0051	28.6	EF-hand domain pair
4	PF13833 EF-hand_8	17	16.6	EF-hand domain pair
5	PF08726 EFhand_Ca_insen	1.7	20.2	Ca2+ insensitive EF hand
6	PF01023 S_100	1.1e-13	61.8	S-100/ICaBP type calcium binding domain
7	PF20155 TMP_3	67	14.7	Tape measure protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000000992

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000007399	0.999	Annexin A2
2	9601.ENSPPYP00000003656	0.981	AHNAK nucleoprotein
3	9601.ENSPPYP00000021609	0.915	Annexin A1
4	9601.ENSPPYP00000024703	0.900	Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1 and C5. Cleavage of fibronectin and laminin leads to cell detachment and apoptosis. Also cleaves fibrin, thrombospondin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Bind [...]
5	9601.ENSPPYP00000020802	0.889	Converts the abundant, but inactive, zymogen plasminogen to plasmin by hydrolyzing a single Arg-Val bond in plasminogen. By controlling plasmin-mediated proteolysis, it plays an important role in tissue remodeling and degradation, in cell migration and many other physiopathological events (By similarity)
6	9601.ENSPPYP00000015873	0.885	Helicase-like transcription factor
7	9601.ENSPPYP00000023892	0.841	Lipoprotein, Lp(a)
8	9601.ENSPPYP00000007040	0.808	Uncharacterized protein
9	9601.ENSPPYP00000013522	0.798	Uncharacterized protein
10	9601.ENSPPYP00000004459	0.795	Nicotinamide N-methyltransferase
11	9601.ENSPPYP00000002609	0.775	Annexin
12	9601.ENSPPYP00000000947	0.758	S100 calcium binding protein A6
13	9601.ENSPPYP00000020311	0.739	Transient receptor potential cation channel, subfamily V, member 6
14	9601.ENSPPYP00000024700	0.732	Annexin A7
15	9601.ENSPPYP00000010063	0.723	Uncharacterized protein
16	9601.ENSPPYP00000024124	0.723	Uncharacterized protein
17	9601.ENSPPYP00000018790	0.718	5-hydroxytryptamine (serotonin) receptor 1B, G protein-coupled
18	9601.ENSPPYP00000008938	0.681	Vesicle-associated membrane protein 2 (synaptobrevin 2)
19	9601.ENSPPYP00000002667	0.680	Annexin A11
20	9601.ENSPPYP00000021160	0.678	Annexin A13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.960	identical protein binding
GO:0046872	0.876	metal ion binding
GO:0046983	0.808	protein dimerization activity
GO:0005509	0.740	calcium ion binding
GO:0042803	0.674	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0048518	0.931	positive regulation of biological process
GO:0060255	0.929	regulation of macromolecule metabolic process
GO:0010468	0.922	regulation of gene expression
GO:0048522	0.907	positive regulation of cellular process
GO:0051171	0.896	regulation of nitrogen compound metabolic process
GO:0080090	0.883	regulation of primary metabolic process
GO:0044093	0.861	positive regulation of molecular function
GO:0009893	0.861	positive regulation of metabolic process
GO:0051179	0.799	localization
GO:0010810	0.790	regulation of cell-substrate adhesion
GO:0051128	0.777	regulation of cellular component organization
GO:0010604	0.761	positive regulation of macromolecule metabolic process
GO:0031323	0.752	regulation of cellular metabolic process
GO:1903317	0.751	regulation of protein maturation
GO:0043085	0.748	positive regulation of catalytic activity
GO:0032956	0.710	regulation of actin cytoskeleton organization
GO:1902903	0.708	regulation of supramolecular fiber organization
GO:0150116	0.683	regulation of cell-substrate junction organization
GO:1903319	0.653	positive regulation of protein maturation
GO:0016043	0.640	cellular component organization
GO:0044087	0.634	regulation of cellular component biogenesis
GO:0110053	0.616	regulation of actin filament organization
GO:0001952	0.613	regulation of cell-matrix adhesion
GO:0110020	0.610	regulation of actomyosin structure organization
GO:0050896	0.607	response to stimulus
GO:0051641	0.596	cellular localization
GO:1900024	0.576	regulation of substrate adhesion-dependent cell spreading
GO:0072657	0.572	protein localization to membrane
GO:0032231	0.547	regulation of actin filament bundle assembly
GO:0045785	0.520	positive regulation of cell adhesion
GO:0070613	0.496	regulation of protein processing
GO:0071704	0.490	organic substance metabolic process
GO:1901888	0.460	regulation of cell junction assembly
GO:0051492	0.454	regulation of stress fiber assembly
GO:0090109	0.453	regulation of cell-substrate junction assembly
GO:0010811	0.439	positive regulation of cell-substrate adhesion
GO:0044238	0.425	primary metabolic process
GO:0048519	0.403	negative regulation of biological process
GO:0006807	0.345	nitrogen compound metabolic process
GO:0044089	0.334	positive regulation of cellular component biogenesis
GO:0051234	0.322	establishment of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.997	membrane
GO:0071944	0.996	cell periphery
GO:0012505	0.992	endomembrane system
GO:0005737	0.981	cytoplasm
GO:0005576	0.976	extracellular region
GO:0005886	0.968	plasma membrane
GO:0032991	0.962	protein-containing complex
GO:0005634	0.947	nucleus
GO:0070062	0.909	extracellular exosome
GO:0031012	0.828	extracellular matrix
GO:0005667	0.517	transcription regulator complex
GO:0098796	0.496	membrane protein complex
GO:0062023	0.462	collagen-containing extracellular matrix
GO:0090575	0.416	RNA polymerase II transcription regulator complex
GO:0070013	0.407	intracellular organelle lumen
GO:0045121	0.354	membrane raft
GO:0005654	0.328	nucleoplasm
GO:0031410	0.315	cytoplasmic vesicle
GO:0098797	0.309	plasma membrane protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]