StarFunc result for job id P60953

User Input

>input (191 residues)
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P40793	0.999	0.999	3.561E-39	191	0.927	0.927	P40793.pdb.gz	CDC42_DROME Cdc42 homolog OS=Drosophila melanogaster OX=7227 GN=Cdc42 PE=1 SV=1
2	AFDB:Q05062	0.987	0.987	2.703E-38	191	0.864	0.864	Q05062.pdb.gz	CDC42_CAEEL Cell division control protein 42 homolog OS=Caenorhabditis elegans OX=6239 GN=cdc-42 PE=1 SV=2
3	AFDB:Q01112	0.977	0.972	1.767E-36	192	0.822	0.818	Q01112.pdb.gz	CDC42_SCHPO Cell division control protein 42 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc42 PE=1 SV=1
4	AFDB:P0CY33	0.969	0.969	2.584E-36	191	0.770	0.770	P0CY33.pdb.gz	CDC42_CANAL Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC42 PE=3 SV=1
5	AFDB:P19073	0.956	0.956	2.090E-35	191	0.801	0.801	P19073.pdb.gz	CDC42_YEAST Cell division control protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC42 PE=1 SV=2
6	PDB:1nf3A	0.931	0.917	6.782E-35	194	0.984	0.969	1nf3A.pdb.gz	Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6
7	AFDB:A2QFE0	0.950	0.945	9.956E-34	192	0.796	0.792	A2QFE0.pdb.gz	A2QFE0_ASPNC Cell division control protein 42 homolog OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An02g14200 PE=3 SV=1
8	AFDB:P40792	0.965	0.960	2.575E-33	192	0.696	0.693	P40792.pdb.gz	RAC1_DROME Ras-related protein Rac1 OS=Drosophila melanogaster OX=7227 GN=Rac1 PE=1 SV=2
9	AFDB:A0A286QZ36	0.963	0.958	4.273E-33	192	0.686	0.682	A0A286QZ36.pdb.gz	RAC1_STIJA Ras-related protein Rac1 OS=Stichopus japonicus OX=307972 GN=RAC1 PE=2 SV=1
10	AFDB:A2BHI1	0.949	0.830	8.051E-33	219	0.691	0.603	A2BHI1.pdb.gz
11	AFDB:Q7JWS8	0.945	0.926	3.922E-32	195	0.628	0.615	Q7JWS8.pdb.gz	Q7JWS8_DROME AT17867p OS=Drosophila melanogaster OX=7227 GN=Mtl PE=1 SV=1
12	PDB:2wkpA	0.918	0.552	1.671E-29	320	0.654	0.391	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
13	PDB:6jikA	0.907	0.951	5.323E-27	182	0.503	0.527	6jikA.pdb.gz	Aspergillus fumigatus Rho1 gSGTP complex
14	PDB:6hxuA	0.915	0.959	7.784E-27	182	0.487	0.511	6hxuA.pdb.gz	A Targeted Protein Degradation Cell-Based Screening for Nanobodies Selective toward the Cellular RHOB GTP-Bound Conformation.
15	PDB:5c2kA	0.904	0.456	1.138E-26	382	0.503	0.251	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
16	PDB:2atxA	0.903	0.927	1.213E-26	186	0.649	0.667	2atxA.pdb.gz	An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins
17	PDB:6ukaA	0.900	0.970	1.665E-26	177	0.571	0.616	6ukaA.pdb.gz	Structure of the DOCK2-ELMO1 complex provides insights into regulation of the auto-inhibited state.
18	PDB:4mitC	0.910	0.960	4.040E-26	181	0.497	0.525	4mitC.pdb.gz	Entamoeba histolytica RacC Selectively Engages p21-Activated Kinase Effectors.
19	PDB:3a58F	0.903	0.952	9.002E-25	181	0.476	0.503	3a58F.pdb.gz	Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3
20	PDB:2j0vB	0.845	0.875	2.226E-22	184	0.487	0.505	2j0vB.pdb.gz	The Crystal Structure of Arabidopsis Thaliana Rac7/Rop9: The First Ras Superfamily Gtpase from the Plant Kingdom.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P60766	4.11e-141	392	191	1.000	1.000	CDC42_MOUSE Cell division control protein 42 homolog OS=Mus musculus OX=10090 GN=Cdc42 PE=1 SV=2
2	P60953	4.11e-141	392	191	1.000	1.000	CDC42_HUMAN Cell division control protein 42 homolog OS=Homo sapiens OX=9606 GN=CDC42 PE=1 SV=2
3	Q8CFN2	4.11e-141	392	191	1.000	1.000	CDC42_RAT Cell division control protein 42 homolog OS=Rattus norvegicus OX=10116 GN=Cdc42 PE=1 SV=2
4	Q6PFU4	8.60e-140	389	191	0.990	0.990	Q6PFU4_DANRE Cell division control protein 42 homolog OS=Danio rerio OX=7955 GN=cdc42a PE=1 SV=1
5	Q52WY2	1.19e-135	379	191	0.953	0.953	Q52WY2_DANRE Cell division control protein 42 homolog OS=Danio rerio OX=7955 GN=cdc42a PE=1 SV=1
6	P40793	1.58e-130	365	191	0.927	0.927	CDC42_DROME Cdc42 homolog OS=Drosophila melanogaster OX=7227 GN=Cdc42 PE=1 SV=1
7	Q05062	8.59e-126	353	191	0.864	0.864	CDC42_CAEEL Cell division control protein 42 homolog OS=Caenorhabditis elegans OX=6239 GN=cdc-42 PE=1 SV=2
8	Q01112	1.15e-114	325	192	0.822	0.818	CDC42_SCHPO Cell division control protein 42 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc42 PE=1 SV=1
9	P19073	1.97e-114	325	191	0.801	0.801	CDC42_YEAST Cell division control protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC42 PE=1 SV=2
10	G5EAY4	3.34e-111	317	192	0.796	0.792	G5EAY4_EMENI Cell division control protein 42 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07487 PE=3 SV=1
11	P0CY33	3.60e-111	317	191	0.770	0.770	CDC42_CANAL Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC42 PE=3 SV=1
12	A2QFE0	5.48e-111	316	192	0.796	0.792	A2QFE0_ASPNC Cell division control protein 42 homolog OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An02g14200 PE=3 SV=1
13	P62998	2.31e-99	287	192	0.707	0.703	RAC1_BOVIN Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus OX=9913 GN=RAC1 PE=1 SV=1
14	P63000	2.31e-99	287	192	0.707	0.703	RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1
15	P63001	2.31e-99	287	192	0.707	0.703	RAC1_MOUSE Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus OX=10090 GN=Rac1 PE=1 SV=1
16	Q6LC82	2.31e-99	287	192	0.707	0.703	Q6LC82_CHICK GTPase cRac1A OS=Gallus gallus OX=9031 GN=cRac1A PE=2 SV=1
17	Q6RUV5	2.31e-99	287	192	0.707	0.703	RAC1_RAT Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus OX=10116 GN=Rac1 PE=1 SV=1
18	A9JRY8	6.26e-99	286	192	0.702	0.698	A9JRY8_DANRE Rac family small GTPase 3b OS=Danio rerio OX=7955 GN=rac3b PE=1 SV=1
19	P40792	6.90e-98	283	192	0.696	0.693	RAC1_DROME Ras-related protein Rac1 OS=Drosophila melanogaster OX=7227 GN=Rac1 PE=1 SV=2
20	Q03206	6.97e-98	283	191	0.660	0.660	RAC1_CAEEL Ras-related protein ced-10 OS=Caenorhabditis elegans OX=6239 GN=ced-10 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00025 Arf	0.00016	32.7	ADP-ribosylation factor family
2	PF00009 GTP_EFTU	9.5	17.2	Elongation factor Tu GTP binding domain
3	PF15786 PET117	3.3	19.4	PET assembly of cytochrome c oxidase, mitochondrial
4	PF00071 Ras	4.5e-50	180.9	Ras family
5	PF08477 Roc	1e-15	69.4	Ras of Complex, Roc, domain of DAPkinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008846776.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008840766.1	0.999	Wiskott-Aldrich syndrome
2	1026970.XP_008842432.1	0.999	P21 (RAC1) activated kinase 1
3	1026970.XP_008850992.1	0.999	Ras GTPase-activating-like protein IQGAP1
4	1026970.XP_008833381.1	0.998	Par-6 family cell polarity regulator beta
5	1026970.XP_008823097.1	0.997	Neural Wiskott-Aldrich syndrome protein
6	1026970.XP_008854219.1	0.997	Ras GTPase-activating-like protein IQGAP2
7	1026970.XP_008836758.1	0.996	Tyrosine kinase non receptor 2
8	1026970.XP_008837296.1	0.996	Par-6 family cell polarity regulator alpha
9	1026970.XP_008841771.1	0.996	Rho GTPase activating protein 1
10	1026970.XP_008852167.1	0.996	P21 (RAC1) activated kinase 4
11	1026970.XP_008826976.1	0.995	BAI1 associated protein 2
12	1026970.XP_008836736.1	0.993	P21 (RAC1) activated kinase 2
13	1026970.XP_008834160.1	0.991	Intersectin-1 isoform X1
14	1026970.XP_008837055.1	0.990	Phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
15	1026970.XP_008846622.1	0.990	Rho guanine nucleotide exchange factor 7
16	1026970.XP_008851169.1	0.990	P21 (RAC1) activated kinase 3
17	1026970.XP_008825415.1	0.989	P21 (RAC1) activated kinase 5
18	1026970.XP_008840536.1	0.989	Serine/threonine-protein kinase PAK 6
19	1026970.XP_008820413.1	0.987	Mitogen-activated protein kinase kinase kinase 11 isoform X1
20	1026970.XP_008847466.1	0.985	Par-6 family cell polarity regulator gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003924	0.977	GTPase activity
GO:0097367	0.887	carbohydrate derivative binding
GO:0097159	0.871	organic cyclic compound binding
GO:1901363	0.869	heterocyclic compound binding
GO:0043167	0.867	ion binding
GO:0036094	0.863	small molecule binding
GO:0000166	0.764	nucleotide binding
GO:0043168	0.759	anion binding
GO:0019899	0.724	enzyme binding
GO:0017076	0.714	purine nucleotide binding
GO:0032561	0.661	guanyl ribonucleotide binding
GO:0005525	0.648	GTP binding
GO:0019900	0.565	kinase binding
GO:0019901	0.508	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.983	regulation of cellular process
GO:0032501	0.975	multicellular organismal process
GO:0050896	0.972	response to stimulus
GO:0048856	0.968	anatomical structure development
GO:0048518	0.960	positive regulation of biological process
GO:0048522	0.933	positive regulation of cellular process
GO:0071840	0.928	cellular component organization or biogenesis
GO:0007275	0.928	multicellular organism development
GO:0044087	0.927	regulation of cellular component biogenesis
GO:0016043	0.911	cellular component organization
GO:0048731	0.901	system development
GO:0009653	0.895	anatomical structure morphogenesis
GO:0051128	0.882	regulation of cellular component organization
GO:0051179	0.874	localization
GO:0051130	0.867	positive regulation of cellular component organization
GO:0048513	0.859	animal organ development
GO:0006996	0.851	organelle organization
GO:0048869	0.821	cellular developmental process
GO:0030154	0.771	cell differentiation
GO:0016477	0.765	cell migration
GO:0051716	0.760	cellular response to stimulus
GO:0031346	0.734	positive regulation of cell projection organization
GO:0007154	0.731	cell communication
GO:0023052	0.725	signaling
GO:0035295	0.723	tube development
GO:0060491	0.719	regulation of cell projection assembly
GO:0007165	0.695	signal transduction
GO:0030030	0.692	cell projection organization
GO:0120032	0.692	regulation of plasma membrane bounded cell projection assembly
GO:0035556	0.688	intracellular signal transduction
GO:0051641	0.687	cellular localization
GO:0044085	0.682	cellular component biogenesis
GO:0007264	0.679	small GTPase mediated signal transduction
GO:0051491	0.679	positive regulation of filopodium assembly
GO:0048468	0.677	cell development
GO:0033043	0.675	regulation of organelle organization
GO:0007399	0.674	nervous system development
GO:0001525	0.673	angiogenesis
GO:0022607	0.644	cellular component assembly
GO:0010592	0.634	positive regulation of lamellipodium assembly
GO:0030182	0.626	neuron differentiation
GO:0046847	0.614	filopodium assembly
GO:0001894	0.612	tissue homeostasis
GO:0051049	0.609	regulation of transport
GO:0032402	0.606	melanosome transport
GO:0009888	0.599	tissue development
GO:0060041	0.588	retina development in camera-type eye
GO:0001667	0.580	ameboidal-type cell migration
GO:0048598	0.570	embryonic morphogenesis
GO:0009887	0.529	animal organ morphogenesis
GO:0007010	0.524	cytoskeleton organization
GO:0023051	0.509	regulation of signaling
GO:0048583	0.486	regulation of response to stimulus
GO:0019222	0.466	regulation of metabolic process
GO:0010646	0.445	regulation of cell communication
GO:0048666	0.428	neuron development
GO:0048729	0.404	tissue morphogenesis
GO:0042221	0.400	response to chemical
GO:0060255	0.399	regulation of macromolecule metabolic process
GO:0007163	0.394	establishment or maintenance of cell polarity
GO:0048519	0.366	negative regulation of biological process
GO:0048523	0.347	negative regulation of cellular process
GO:0051239	0.313	regulation of multicellular organismal process
GO:0031323	0.309	regulation of cellular metabolic process
GO:0009966	0.309	regulation of signal transduction
GO:0080090	0.308	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0071944	0.998	cell periphery
GO:0043226	0.998	organelle
GO:0012505	0.992	endomembrane system
GO:0043229	0.983	intracellular organelle
GO:0043227	0.977	membrane-bounded organelle
GO:0005886	0.964	plasma membrane
GO:0005829	0.943	cytosol
GO:0043231	0.934	intracellular membrane-bounded organelle
GO:0030054	0.815	cell junction
GO:0031982	0.771	vesicle
GO:0032991	0.634	protein-containing complex
GO:0042995	0.418	cell projection
GO:0043228	0.377	non-membrane-bounded organelle
GO:0120025	0.345	plasma membrane bounded cell projection
GO:0043232	0.343	intracellular non-membrane-bounded organelle
GO:0005856	0.334	cytoskeleton
GO:0005634	0.301	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.977	GTP + H2O = GDP + H(+) + phosphate

[back to server]