StarFunc result for job id P61006

User Input

>input (207 residues)
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG
NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN
SPQGSNQGVKITPDQQKRSSFFRCVLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4FVK4	0.920	0.920	6.121E-42	207	0.932	0.932	A4FVK4.pdb.gz	A4FVK4_DANRE RAB8A, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8 PE=1 SV=1
2	AFDB:A5PLC7	0.890	0.882	1.504E-38	209	0.831	0.823	A5PLC7.pdb.gz	A5PLC7_DANRE RAB8B, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8bb PE=1 SV=1
3	AFDB:G5EFC1	0.911	0.894	9.875E-37	211	0.739	0.725	G5EFC1.pdb.gz	G5EFC1_CAEEL Rab8 OS=Caenorhabditis elegans OX=6239 GN=rab-8 PE=1 SV=1
4	AFDB:O18338	0.899	0.899	1.268E-36	207	0.792	0.792	O18338.pdb.gz	O18338_DROME LD44762p OS=Drosophila melanogaster OX=7227 GN=Rab8 PE=1 SV=1
5	AFDB:Q7T3A4	0.838	0.867	9.430E-35	200	0.652	0.675	Q7T3A4.pdb.gz	RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio OX=7955 GN=rab13 PE=1 SV=1
6	AFDB:Q94148	0.840	0.865	6.958E-34	201	0.667	0.687	Q94148.pdb.gz	RAB10_CAEEL Ras-related protein Rab-10 OS=Caenorhabditis elegans OX=6239 GN=rab-10 PE=1 SV=2
7	AFDB:Q9SF91	0.948	0.901	2.749E-33	218	0.594	0.564	Q9SF91.pdb.gz	RAE1E_ARATH Ras-related protein RABE1e OS=Arabidopsis thaliana OX=3702 GN=RABE1E PE=1 SV=1
8	PDB:5sziA	0.824	0.979	4.371E-33	174	0.836	0.994	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
9	AFDB:O24466	0.906	0.869	5.133E-33	216	0.618	0.593	O24466.pdb.gz	RAE1A_ARATH Ras-related protein RABE1a OS=Arabidopsis thaliana OX=3702 GN=RABE1A PE=1 SV=1
10	AFDB:A2R2A0	0.889	0.894	7.948E-33	206	0.614	0.617	A2R2A0.pdb.gz	A2R2A0_ASPNC Secretion related GTPase srgA-Aspergillus niger OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=srgA PE=4 SV=1
11	AFDB:P20790	0.851	0.847	7.948E-33	208	0.633	0.630	P20790.pdb.gz	RAB8A_DICDI Ras-related protein Rab-8A OS=Dictyostelium discoideum OX=44689 GN=rab8A PE=3 SV=1
12	PDB:5szjA	0.813	0.961	2.399E-30	175	0.638	0.754	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
13	PDB:5szhB	0.820	0.968	2.617E-27	175	0.493	0.583	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
14	PDB:1zbdA	0.836	0.976	8.121E-26	177	0.459	0.537	1zbdA.pdb.gz	Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
15	PDB:8a4cB	0.812	0.987	1.963E-24	170	0.440	0.535	8a4cB.pdb.gz	Rep15 interacts with several Rab GTPases and has a distinct fold for a Rab effector.
16	PDB:2f9mA	0.823	0.933	2.367E-24	182	0.391	0.445	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.
17	PDB:6if2B	0.820	0.950	3.902E-24	178	0.415	0.483	6if2B.pdb.gz	Rab35/ACAP2 and Rab35/RUSC2 Complex Structures Reveal Molecular Basis for Effector Recognition by Rab35 GTPase.
18	PDB:2ew1A	0.800	0.966	9.956E-24	171	0.391	0.474	2ew1A.pdb.gz	Crystal structure of RAB30 in complex with a GTP analogue
19	PDB:6y7gB	0.743	0.924	2.541E-23	165	0.435	0.545	6y7gB.pdb.gz	Structure of the human RAB3C in complex with GDP
20	PDB:1ukvY	0.790	0.828	1.137E-22	197	0.478	0.503	1ukvY.pdb.gz	Structure of Rab GDP-dissociation inhibitor in complex with prenylated YPT1 GTPase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61006	6.80e-154	426	207	1.000	1.000	RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens OX=9606 GN=RAB8A PE=1 SV=1
2	P61007	6.80e-154	426	207	1.000	1.000	RAB8A_CANLF Ras-related protein Rab-8A OS=Canis lupus familiaris OX=9615 GN=RAB8A PE=1 SV=1
3	P35280	5.04e-149	414	207	0.971	0.971	RAB8A_RAT Ras-related protein Rab-8A OS=Rattus norvegicus OX=10116 GN=Rab8a PE=1 SV=2
4	P55258	5.04e-149	414	207	0.971	0.971	RAB8A_MOUSE Ras-related protein Rab-8A OS=Mus musculus OX=10090 GN=Rab8a PE=1 SV=2
5	A4FVK4	2.46e-144	402	207	0.932	0.932	A4FVK4_DANRE RAB8A, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8 PE=1 SV=1
6	Q92930	5.04e-128	360	207	0.826	0.826	RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens OX=9606 GN=RAB8B PE=1 SV=2
7	P61028	5.81e-128	360	207	0.826	0.826	RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus OX=10090 GN=Rab8b PE=1 SV=1
8	P70550	5.81e-128	360	207	0.826	0.826	RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus OX=10116 GN=Rab8b PE=1 SV=1
9	A5PLC7	3.73e-126	356	209	0.826	0.818	A5PLC7_DANRE RAB8B, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8bb PE=1 SV=1
10	O18338	4.05e-120	340	207	0.792	0.792	O18338_DROME LD44762p OS=Drosophila melanogaster OX=7227 GN=Rab8 PE=1 SV=1
11	G5EFC1	2.53e-111	318	211	0.739	0.725	G5EFC1_CAEEL Rab8 OS=Caenorhabditis elegans OX=6239 GN=rab-8 PE=1 SV=1
12	Q7T3A4	2.48e-99	288	200	0.662	0.685	RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio OX=7955 GN=rab13 PE=1 SV=1
13	O15971	7.12e-98	284	204	0.671	0.681	O15971_DROME LD39986p OS=Drosophila melanogaster OX=7227 GN=Rab10 PE=1 SV=1
14	Q94148	3.47e-97	282	201	0.662	0.682	RAB10_CAEEL Ras-related protein Rab-10 OS=Caenorhabditis elegans OX=6239 GN=rab-10 PE=1 SV=2
15	Q6DGV5	6.41e-97	282	201	0.657	0.677	Q6DGV5_DANRE RAB10, member RAS oncogene family OS=Danio rerio OX=7955 GN=zgc:92757 PE=1 SV=1
16	P61026	2.66e-96	280	200	0.657	0.680	RAB10_HUMAN Ras-related protein Rab-10 OS=Homo sapiens OX=9606 GN=RAB10 PE=1 SV=1
17	P61027	2.66e-96	280	200	0.657	0.680	RAB10_MOUSE Ras-related protein Rab-10 OS=Mus musculus OX=10090 GN=Rab10 PE=1 SV=1
18	P24409	1.13e-95	278	200	0.652	0.675	RAB10_CANLF Ras-related protein Rab-10 OS=Canis lupus familiaris OX=9615 GN=RAB10 PE=1 SV=1
19	Q9DD03	3.10e-95	278	202	0.638	0.653	RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus OX=10090 GN=Rab13 PE=1 SV=1
20	P35286	8.30e-95	276	203	0.614	0.626	RAB13_RAT Ras-related protein Rab-13 OS=Rattus norvegicus OX=10116 GN=Rab13 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	5.5e+02	12.3	AAA ATPase domain
2	PF12775 AAA_7	2.5e+02	12.6	P-loop containing dynein motor region
3	PF00025 Arf	4.8e-13	60.4	ADP-ribosylation factor family
4	PF13124 DUF3963	88	14.5	Protein of unknown function (DUF3963)
5	PF00009 GTP_EFTU	9.8	17.2	Elongation factor Tu GTP binding domain
6	PF04670 Gtr1_RagA	0.036	25.0	Gtr1/RagA G protein conserved region
7	PF01926 MMR_HSR1	6	18.4	50S ribosome-binding GTPase
8	PF09682 Phage_holin_6_1	3.6e+02	13.0	Bacteriophage holin of superfamily 6 (Holin_LLH)
9	PF00071 Ras	3e-63	223.7	Ras family
10	PF08477 Roc	2.1e-30	116.8	Ras of Complex, Roc, domain of DAPkinase
11	PF03193 RsgA_GTPase	12	17.2	RsgA GTPase
12	PF00735 Septin	84	13.9	Septin
13	PF09439 SRPRB	1.2	20.0	Signal recognition particle receptor beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008585768.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008570621.1	0.994	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 19 Proteins, and 93% coverage of the annotated genomic feature by RNAseq alignments
2	482537.XP_008581990.1	0.981	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 9 Proteins, and 94% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
3	482537.XP_008586062.1	0.980	Optineurin isoform X1
4	482537.XP_008586909.1	0.976	Guanine nucleotide exchange factor for Rab-3A
5	482537.XP_008586792.1	0.967	rab-3A-interacting protein
6	482537.XP_008591006.1	0.967	rab-3A-interacting protein isoform X1
7	482537.XP_008585024.1	0.945	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
8	482537.XP_008584175.1	0.944	Ras-related protein Rab-11A isoform X1
9	482537.XP_008567218.1	0.923	Exocyst complex component 6
10	482537.XP_008564434.1	0.920	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 7 Proteins, and 71% coverage of the annotated genomic feature by RNAseq alignments
11	482537.XP_008572103.1	0.915	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 31 Proteins, and 33% coverage of the annotated genomic feature by RNAseq alignments
12	482537.XP_008577322.1	0.915	WD repeat-containing protein 41 isoform X1
13	482537.XP_008572466.1	0.914	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 76% coverage of the annotated genomic feature by RNAseq alignments
14	482537.XP_008567641.1	0.912	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 26 mRNAs, 24 Proteins, and 95% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
15	482537.XP_008587159.1	0.912	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 mRNAs, 27 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
16	482537.XP_008575200.1	0.907	Exocyst complex component 3
17	482537.XP_008581351.1	0.900	dnaJ homolog subfamily C member 14 isoform X1
18	482537.XP_008587463.1	0.887	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 10 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
19	482537.XP_008568135.1	0.876	Protein C9orf72 homolog isoform X1
20	482537.XP_008580685.1	0.872	Exocyst complex component 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0043167	0.859	ion binding
GO:0019001	0.836	guanyl nucleotide binding
GO:0032555	0.827	purine ribonucleotide binding
GO:0032561	0.820	guanyl ribonucleotide binding
GO:0043168	0.818	anion binding
GO:0003824	0.810	catalytic activity
GO:0017111	0.789	ribonucleoside triphosphate phosphatase activity
GO:0003924	0.781	GTPase activity
GO:0005525	0.505	GTP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0051179	0.982	localization
GO:0071840	0.965	cellular component organization or biogenesis
GO:0051641	0.953	cellular localization
GO:0065007	0.948	biological regulation
GO:0006810	0.929	transport
GO:0050789	0.916	regulation of biological process
GO:0050794	0.882	regulation of cellular process
GO:0016043	0.854	cellular component organization
GO:0046907	0.802	intracellular transport
GO:0016192	0.712	vesicle-mediated transport
GO:0120036	0.671	plasma membrane bounded cell projection organization
GO:0033036	0.616	macromolecule localization
GO:0051668	0.604	localization within membrane
GO:0006996	0.446	organelle organization
GO:0050896	0.362	response to stimulus
GO:0016197	0.356	endosomal transport
GO:0098876	0.333	vesicle-mediated transport to the plasma membrane
GO:0048518	0.328	positive regulation of biological process
GO:0032501	0.311	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0031982	0.998	vesicle
GO:0031410	0.994	cytoplasmic vesicle
GO:0071944	0.963	cell periphery
GO:0005886	0.896	plasma membrane
GO:0031090	0.855	organelle membrane
GO:0005829	0.831	cytosol
GO:0042995	0.713	cell projection
GO:0120025	0.629	plasma membrane bounded cell projection
GO:0030133	0.588	transport vesicle
GO:0005768	0.539	endosome
GO:0099503	0.536	secretory vesicle
GO:0055037	0.511	recycling endosome
GO:0012506	0.509	vesicle membrane
GO:0030659	0.498	cytoplasmic vesicle membrane
GO:0098588	0.470	bounding membrane of organelle
GO:0070382	0.453	exocytic vesicle
GO:1903561	0.445	extracellular vesicle
GO:0070062	0.423	extracellular exosome
GO:0043228	0.395	non-membrane-bounded organelle
GO:0043232	0.388	intracellular non-membrane-bounded organelle
GO:0005794	0.330	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23680	0.789	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.789	nucleoside-triphosphate phosphatase.
RHEA:19669	0.781	GTP + H2O = GDP + H(+) + phosphate

[back to server]