StarFunc result for job id P61011

User Input

>input (504 residues)
MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI
DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSK
LAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFK
NENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKV
DVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDI
EGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFM
SKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQEL
LTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGL
QSMMRQFQQGAAGNMKGMMGFNNM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61010	0.987	0.987	1.332E-80	504	1.000	1.000	P61010.pdb.gz	SRP54_CANLF Signal recognition particle subunit SRP54 OS=Canis lupus familiaris OX=9615 GN=SRP54 PE=1 SV=1
2	PDB:7obrx	0.801	0.824	1.031E-63	488	0.964	0.996	7obrx.pdb.gz	Molecular mechanism of cargo recognition and handover by the mammalian signal recognition particle.
3	AFDB:G3V480	0.755	0.849	1.117E-63	447	0.885	0.998	G3V480.pdb.gz	G3V480_HUMAN Signal recognition particle 54 kDa protein OS=Homo sapiens OX=9606 GN=SRP54 PE=1 SV=2
4	AFDB:Q385M8	0.851	0.879	1.052E-53	487	0.510	0.528	Q385M8.pdb.gz	Q385M8_TRYB2 Signal recognition particle 54 kDa protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3070 PE=3 SV=1
5	AFDB:P49966	0.863	0.875	1.562E-53	497	0.520	0.527	P49966.pdb.gz	SR542_ARATH Signal recognition particle subunit SRP54 2 OS=Arabidopsis thaliana OX=3702 GN=SRP-54B PE=3 SV=2
6	AFDB:Q8IKX4	0.857	0.863	7.222E-53	500	0.484	0.488	Q8IKX4.pdb.gz	Q8IKX4_PLAF7 Signal recognition particle 54 kDa protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1450100 PE=3 SV=1
7	AFDB:P21565	0.853	0.824	8.966E-52	522	0.532	0.513	P21565.pdb.gz	SRP54_SCHPO Signal recognition particle subunit SRP54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srp54 PE=1 SV=1
8	PDB:7obqx	0.529	0.672	2.194E-49	393	0.778	0.997	7obqx.pdb.gz	Molecular mechanism of cargo recognition and handover by the mammalian signal recognition particle.
9	AFDB:Q75K18	0.809	0.755	1.479E-48	542	0.478	0.445	Q75K18.pdb.gz	SRP54_DICDI Signal recognition particle subunit SRP54 OS=Dictyostelium discoideum OX=44689 GN=srp54 PE=1 SV=1
10	AFDB:P20424	0.833	0.778	6.508E-48	541	0.494	0.460	P20424.pdb.gz	SRP54_YEAST Signal recognition particle subunit SRP54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRP54 PE=1 SV=2
11	AFDB:Q57565	0.729	0.808	2.354E-39	451	0.387	0.432	Q57565.pdb.gz	SRP54_METJA Signal recognition particle 54 kDa protein OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=srp54 PE=1 SV=1
12	AFDB:P9WGD7	0.563	0.541	1.501E-34	525	0.288	0.276	P9WGD7.pdb.gz	SRP54_MYCTU Signal recognition particle protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ffh PE=1 SV=1
13	PDB:3ndbB	0.552	0.657	4.132E-31	420	0.373	0.448	3ndbB.pdb.gz	Structural basis of signal-sequence recognition by the signal recognition particle.
14	PDB:2ffhA	0.539	0.659	5.068E-28	407	0.278	0.344	2ffhA.pdb.gz
15	PDB:5gadi	0.752	0.835	9.632E-28	450	0.246	0.276	5gadi.pdb.gz	Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
16	PDB:2q9cA	0.467	0.755	9.646E-20	304	0.200	0.332	2q9cA.pdb.gz	X-ray Structures of the Signal Recognition Particle Receptor Reveal Targeting Cycle Intermediates.
17	PDB:2j289	0.692	0.798	3.156E-19	430	0.260	0.305	2j289.pdb.gz	Following the Signal Sequence from Ribosomal Tunnel Exit to Signal Recognition Particle
18	PDB:2yhsA	0.501	0.791	6.226E-17	308	0.173	0.282	2yhsA.pdb.gz
19	PDB:5l3qB	0.483	0.768	7.970E-17	307	0.129	0.212	5l3qB.pdb.gz	Structural Basis for Conserved Regulation and Adaptation of the Signal Recognition Particle Targeting Complex.
20	PDB:4hi0E	0.256	0.579	6.395E-5	196	0.065	0.168	4hi0E.pdb.gz	Structure of UreG/UreF/UreH complex reveals how urease accessory proteins facilitate maturation of Helicobacter pylori urease.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V480	0.0	871	447	0.867	0.978	G3V480_HUMAN Signal recognition particle 54 kDa protein OS=Homo sapiens OX=9606 GN=SRP54 PE=1 SV=2
2	G3V4F7	0.0	912	440	0.873	1.000	G3V4F7_HUMAN Signal recognition particle 54 kDa protein OS=Homo sapiens OX=9606 GN=SRP54 PE=1 SV=1
3	P21565	0.0	528	522	0.510	0.492	SRP54_SCHPO Signal recognition particle subunit SRP54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srp54 PE=1 SV=1
4	P49966	0.0	534	497	0.520	0.527	SR542_ARATH Signal recognition particle subunit SRP54 2 OS=Arabidopsis thaliana OX=3702 GN=SRP-54B PE=3 SV=2
5	P61010	0.0	1040	504	1.000	1.000	SRP54_CANLF Signal recognition particle subunit SRP54 OS=Canis lupus familiaris OX=9615 GN=SRP54 PE=1 SV=1
6	P61011	0.0	1040	504	1.000	1.000	SRP54_HUMAN Signal recognition particle subunit SRP54 OS=Homo sapiens OX=9606 GN=SRP54 PE=1 SV=1
7	Q385M8	0.0	528	487	0.518	0.536	Q385M8_TRYB2 Signal recognition particle 54 kDa protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3070 PE=3 SV=1
8	Q7ZVN5	0.0	1005	504	0.960	0.960	SRP54_DANRE Signal recognition particle subunit SRP54 OS=Danio rerio OX=7955 GN=srp54 PE=2 SV=1
9	Q8ISC7	0.0	526	487	0.516	0.534	Q8ISC7_9TRYP Signal recognition particle 54 kDa protein OS=Trypanosoma brucei OX=5691 GN=srp54 PE=3 SV=1
10	Q8IKX4	2.22e-179	514	500	0.490	0.494	Q8IKX4_PLAF7 Signal recognition particle 54 kDa protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1450100 PE=3 SV=1
11	Q75K18	3.99e-159	464	542	0.490	0.456	SRP54_DICDI Signal recognition particle subunit SRP54 OS=Dictyostelium discoideum OX=44689 GN=srp54 PE=1 SV=1
12	P20424	3.40e-158	462	541	0.464	0.433	SRP54_YEAST Signal recognition particle subunit SRP54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRP54 PE=1 SV=2
13	Q57565	1.64e-118	357	451	0.393	0.439	SRP54_METJA Signal recognition particle 54 kDa protein OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=srp54 PE=1 SV=1
14	O07347	8.10e-70	231	430	0.292	0.342	SRP54_THEAQ Signal recognition particle protein OS=Thermus aquaticus OX=271 GN=ffh PE=1 SV=3
15	P37107	8.28e-67	227	564	0.264	0.236	SR54C_ARATH Signal recognition particle subunit SRP54, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FFC PE=1 SV=1
16	P9WGD7	6.17e-65	221	525	0.280	0.269	SRP54_MYCTU Signal recognition particle protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ffh PE=1 SV=1
17	A0A0H2UQC2	8.14e-64	218	523	0.306	0.294	A0A0H2UQC2_STRPN Signal recognition particle protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ffh PE=1 SV=1
18	P0AGD7	8.40e-59	202	453	0.272	0.302	SRP54_ECOLI Signal recognition particle protein OS=Escherichia coli (strain K12) OX=83333 GN=ffh PE=1 SV=1
19	A0A0H2UQF6	1.98e-35	139	429	0.171	0.200	A0A0H2UQF6_STRPN Signal recognition particle receptor FtsY OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ftsY PE=1 SV=1
20	P83749	6.72e-35	134	304	0.185	0.306	FTSY_THEAQ Signal recognition particle receptor FtsY OS=Thermus aquaticus OX=271 GN=ftsY PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01591 6PF2K	64	14.3	6-phosphofructo-2-kinase
2	PF00004 AAA	1.6e+02	14.1	ATPase family associated with various cellular activities (AAA)
3	PF13191 AAA_16	38	16.1	AAA ATPase domain
4	PF13207 AAA_17	0.34	22.8	AAA domain
5	PF13238 AAA_18	1.6e+02	14.3	AAA domain
6	PF13401 AAA_22	17	17.1	AAA domain
7	PF13521 AAA_28	4.1e+02	12.6	AAA domain
8	PF13604 AAA_30	11	17.2	AAA domain
9	PF13614 AAA_31	39	15.6	AAA domain
10	PF13671 AAA_33	0.0071	28.0	AAA domain
11	PF01583 APS_kinase	19	16.6	Adenylylsulphate kinase
12	PF02374 ArsA_ATPase	4.5e+02	11.4	Anion-transporting ATPase
13	PF03029 ATP_bind_1	1.6e+02	13.5	Conserved hypothetical ATP binding protein
14	PF01656 CbiA	0.032	25.7	CobQ/CobB/MinD/ParA nucleotide binding domain
15	PF16575 CLP1_P	5.5	18.3	mRNA cleavage and polyadenylation factor CLP1 P-loop
16	PF02492 cobW	0.012	26.7	CobW/HypB/UreG, nucleotide-binding domain
17	PF09974 DUF2209	0.31	22.8	Uncharacterized protein conserved in archaea (DUF2209)
18	PF00503 G-alpha	1.8e+02	12.7	G-protein alpha subunit
19	PF03308 MeaB	2	18.9	Methylmalonyl Co-A mutase-associated GTPase MeaB
20	PF01926 MMR_HSR1	20	16.7	50S ribosome-binding GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010631906.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010616734.1	0.999	Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane
2	885580.XP_010606190.1	0.998	Signal recognition particle 19 kDa protein
3	885580.XP_010638617.1	0.997	Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane
4	885580.XP_010640733.1	0.989	Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.
5	885580.XP_010610310.1	0.970	Signal recognition particle 14 kDa protein-like
6	885580.XP_010622954.1	0.970	Signal recognition particle 14 kDa protein
7	885580.XP_010626951.1	0.940	Signal recognition particle receptor subunit alpha
8	885580.XP_010640599.1	0.908	60S ribosomal protein L23a isoform X1
9	885580.XP_010611821.1	0.886	60S ribosomal protein L35
10	885580.XP_010628746.1	0.833	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 29 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
11	885580.XP_010623787.1	0.829	Serotransferrin
12	885580.XP_010642543.1	0.826	39S ribosomal protein L17, mitochondrial
13	885580.XP_010635429.1	0.821	60S ribosomal protein L31
14	885580.XP_010641619.1	0.816	60S ribosomal protein L4
15	885580.XP_010613252.1	0.811	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 31 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
16	885580.XP_010640796.1	0.811	Bifunctional aminoacyl-tRNA synthetase
17	885580.XP_010613470.1	0.800	Belongs to the universal ribosomal protein uS15 family.
18	885580.XP_010624280.1	0.795	60S ribosomal protein L11
19	885580.XP_010611301.1	0.791	60S ribosomal protein L39
20	885580.XP_010623413.1	0.789	60S ribosomal protein L9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0003674	1.000	molecular_function
GO:0005515	0.994	protein binding
GO:0033218	0.993	amide binding
GO:1901363	0.980	heterocyclic compound binding
GO:0097159	0.980	organic cyclic compound binding
GO:0005048	0.975	signal sequence binding
GO:0003723	0.972	RNA binding
GO:0003824	0.894	catalytic activity
GO:0016787	0.470	hydrolase activity
GO:0016462	0.415	pyrophosphatase activity
GO:0017111	0.412	ribonucleoside triphosphate phosphatase activity
GO:0003924	0.372	GTPase activity
GO:0008312	0.305	7S RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0006605	0.985	protein targeting
GO:0006612	0.982	protein targeting to membrane
GO:0072599	0.981	establishment of protein localization to endoplasmic reticulum
GO:0045047	0.954	protein targeting to ER
GO:0048856	0.428	anatomical structure development
GO:0071840	0.414	cellular component organization or biogenesis
GO:0006613	0.326	cotranslational protein targeting to membrane
GO:0016043	0.308	cellular component organization
GO:0006614	0.306	SRP-dependent cotranslational protein targeting to membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.952	intracellular membrane-bounded organelle
GO:0032991	0.951	protein-containing complex
GO:0005634	0.883	nucleus
GO:1990904	0.770	ribonucleoprotein complex
GO:0043233	0.577	organelle lumen
GO:0070013	0.558	intracellular organelle lumen
GO:0016020	0.303	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.470	Hydrolases.
EC:3.6.1.-	0.415	In phosphorus-containing anhydrides.
RHEA:23680	0.412	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.412	nucleoside-triphosphate phosphatase.
RHEA:19669	0.372	GTP + H2O = GDP + H(+) + phosphate

[back to server]