StarFunc result for job id P61077

User Input

>input (147 residues)
MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLV
PEIARIYKTDRDKYNRISREWTQKYAM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A5PKP9	1.000	1.000	6.690E-31	147	0.905	0.905	A5PKP9.pdb.gz	UB2D4_XENLA Ubiquitin-conjugating enzyme E2 D4 OS=Xenopus laevis OX=8355 GN=ube2d4 PE=1 SV=1
2	AFDB:P70711	0.999	0.999	2.200E-30	147	0.912	0.912	P70711.pdb.gz	U2D2B_RAT Ubiquitin-conjugating enzyme E2 D2B OS=Rattus norvegicus OX=10116 GN=Ube2d2b PE=1 SV=1
3	AFDB:P46595	0.996	0.996	3.107E-28	147	0.844	0.844	P46595.pdb.gz	UBC4_SCHPO Ubiquitin-conjugating enzyme E2 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc4 PE=1 SV=1
4	AFDB:Q8I607	0.998	0.998	5.462E-28	147	0.748	0.748	Q8I607.pdb.gz	Q8I607_PLAF7 Ubiquitin-conjugating enzyme E2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1203900 PE=3 SV=1
5	AFDB:Q9FKT3	0.998	0.992	6.591E-28	148	0.810	0.804	Q9FKT3.pdb.gz	UBC30_ARATH Ubiquitin-conjugating enzyme E2 30 OS=Arabidopsis thaliana OX=3702 GN=UBC30 PE=1 SV=1
6	PDB:3ptfA	0.985	0.947	6.786E-28	153	0.884	0.850	3ptfA.pdb.gz
7	AFDB:Q9SLE4	0.997	0.991	7.471E-28	148	0.769	0.764	Q9SLE4.pdb.gz	UBC29_ARATH Ubiquitin-conjugating enzyme E2 29 OS=Arabidopsis thaliana OX=3702 GN=UBC29 PE=2 SV=1
8	AFDB:P15731	0.989	0.983	1.913E-27	148	0.789	0.784	P15731.pdb.gz	UBC4_YEAST Ubiquitin-conjugating enzyme E2 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC4 PE=1 SV=1
9	PDB:4ddgA	0.978	0.365	3.923E-27	399	0.966	0.356	4ddgA.pdb.gz
10	AFDB:F4JKF3	0.997	0.823	7.130E-27	178	0.796	0.657	F4JKF3.pdb.gz	F4JKF3_ARATH Ubiquitin conjugating enzyme 9 OS=Arabidopsis thaliana OX=3702 GN=UBC9 PE=3 SV=1
11	PDB:4ii2C	0.975	0.962	1.157E-25	149	0.830	0.819	4ii2C.pdb.gz	Structure of a ubiquitin E1-E2 complex: insights to E1-E2 thioester transfer.
12	PDB:4r8pL	0.970	0.567	2.033E-25	254	0.993	0.575	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:7jzvA	0.874	0.529	2.033E-25	253	0.986	0.573	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
14	AFDB:Q96LR5	0.996	0.729	3.260E-25	201	0.633	0.463	Q96LR5.pdb.gz	UB2E2_HUMAN Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens OX=9606 GN=UBE2E2 PE=1 SV=1
15	AFDB:P52483	0.996	0.708	4.748E-25	207	0.639	0.454	P52483.pdb.gz	UB2E3_MOUSE Ubiquitin-conjugating enzyme E2 E3 OS=Mus musculus OX=10090 GN=Ube2e3 PE=1 SV=2
16	PDB:5aieB	0.971	0.952	8.069E-25	150	0.789	0.773	5aieB.pdb.gz	Architecture of the Ubiquitylation Module of the Yeast Ccr4-not Complex.
17	PDB:4x57C	0.981	0.968	1.822E-24	149	0.796	0.785	4x57C.pdb.gz
18	PDB:3bzhA	0.984	0.899	2.065E-24	161	0.633	0.578	3bzhA.pdb.gz
19	PDB:2aakA	0.948	0.930	1.141E-18	150	0.456	0.447	2aakA.pdb.gz
20	PDB:4ccgA	0.940	0.881	1.293E-18	157	0.422	0.395	4ccgA.pdb.gz	Structure of the Human Fancl Ring-Ube2T Complex Reveals Determinants of Cognate E3-E2 Selection.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61077	5.59e-109	307	147	1.000	1.000	UB2D3_HUMAN Ubiquitin-conjugating enzyme E2 D3 OS=Homo sapiens OX=9606 GN=UBE2D3 PE=1 SV=1
2	P61078	5.59e-109	307	147	1.000	1.000	UB2D3_RAT Ubiquitin-conjugating enzyme E2 D3 OS=Rattus norvegicus OX=10116 GN=Ube2d3 PE=2 SV=1
3	P61079	5.59e-109	307	147	1.000	1.000	UB2D3_MOUSE Ubiquitin-conjugating enzyme E2 D3 OS=Mus musculus OX=10090 GN=Ube2d3 PE=1 SV=1
4	P62837	7.98e-107	302	147	0.973	0.973	UB2D2_HUMAN Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens OX=9606 GN=UBE2D2 PE=1 SV=1
5	P62838	7.98e-107	302	147	0.973	0.973	UB2D2_MOUSE Ubiquitin-conjugating enzyme E2 D2 OS=Mus musculus OX=10090 GN=Ube2d2 PE=1 SV=1
6	P62839	7.98e-107	302	147	0.973	0.973	UB2D2_RAT Ubiquitin-conjugating enzyme E2 D2 OS=Rattus norvegicus OX=10116 GN=Ube2d2 PE=1 SV=1
7	Q7ZUK1	4.52e-106	300	147	0.966	0.966	Q7ZUK1_DANRE Ubiquitin-conjugating enzyme E2 D2 OS=Danio rerio OX=7955 GN=zgc:55886 PE=2 SV=1
8	P25867	3.99e-103	293	147	0.939	0.939	UBCD1_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster OX=7227 GN=eff PE=1 SV=1
9	Q9Y2X8	1.21e-102	291	147	0.918	0.918	UB2D4_HUMAN Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens OX=9606 GN=UBE2D4 PE=1 SV=1
10	P35129	1.98e-102	291	147	0.925	0.925	UBC2_CAEEL Ubiquitin-conjugating enzyme E2 2 OS=Caenorhabditis elegans OX=6239 GN=let-70 PE=1 SV=1
11	A5PKP9	2.98e-101	288	147	0.905	0.905	UB2D4_XENLA Ubiquitin-conjugating enzyme E2 D4 OS=Xenopus laevis OX=8355 GN=ube2d4 PE=1 SV=1
12	P70711	1.55e-100	286	147	0.912	0.912	U2D2B_RAT Ubiquitin-conjugating enzyme E2 D2B OS=Rattus norvegicus OX=10116 GN=Ube2d2b PE=1 SV=1
13	D3ZDK2	1.15e-98	281	147	0.884	0.884	UB2D1_RAT Ubiquitin-conjugating enzyme E2 D1 OS=Rattus norvegicus OX=10116 GN=Ube2d1 PE=1 SV=1
14	P51668	1.15e-98	281	147	0.884	0.884	UB2D1_HUMAN Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens OX=9606 GN=UBE2D1 PE=1 SV=1
15	P61080	1.15e-98	281	147	0.884	0.884	UB2D1_MOUSE Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus OX=10090 GN=Ube2d1 PE=1 SV=1
16	P46595	3.06e-93	268	147	0.844	0.844	UBC4_SCHPO Ubiquitin-conjugating enzyme E2 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc4 PE=1 SV=1
17	Q8S920	7.23e-89	257	147	0.803	0.803	UBC5A_ORYSJ Ubiquitin-conjugating enzyme E2 5A OS=Oryza sativa subsp. japonica OX=39947 GN=UBC5A PE=2 SV=1
18	Q6FV50	1.06e-88	256	147	0.796	0.796	Q6FV50_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0E04752g PE=3 SV=1
19	Q9FKT3	1.74e-88	256	148	0.810	0.804	UBC30_ARATH Ubiquitin-conjugating enzyme E2 30 OS=Arabidopsis thaliana OX=3702 GN=UBC30 PE=1 SV=1
20	P15732	2.58e-88	255	148	0.789	0.784	UBC5_YEAST Ubiquitin-conjugating enzyme E2-16 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05773 RWD	42	15.8	RWD domain
2	PF05743 UEV	3e+02	12.7	UEV domain
3	PF00179 UQ_con	1.5e-49	178.7	Ubiquitin-conjugating enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008579069.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008574519.1	0.989	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
2	482537.XP_008564912.1	0.988	E3 ubiquitin-protein ligase RBX1
3	482537.XP_008583987.1	0.985	E3 ubiquitin-protein ligase Mdm2 isoform X1
4	482537.XP_008577853.1	0.984	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
5	482537.XP_008570556.1	0.976	E3 ubiquitin-protein ligase RNF31 isoform X1
6	482537.XP_008577851.1	0.972	Baculoviral IAP repeat-containing protein 2
7	482537.XP_008582939.1	0.970	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 3 Proteins, and 95% coverage of the annotated genomic feature by RNAseq alignments
8	482537.XP_008570143.1	0.969	Breast cancer type 1 susceptibility protein
9	482537.XP_008577384.1	0.967	E3 ubiquitin-protein ligase CHIP
10	482537.XP_008568431.1	0.963	E3 ubiquitin-protein ligase NEDD4-like isoform X1
11	482537.XP_008578982.1	0.959	Baculoviral IAP repeat-containing protein 7
12	482537.XP_008570540.1	0.958	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
13	482537.XP_008565656.1	0.952	Ubiquitin thioesterase OTUB1
14	482537.XP_008586589.1	0.949	E3 ubiquitin-protein ligase RING2
15	482537.XP_008577062.1	0.945	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 mRNAs, 30 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
16	482537.XP_008568975.1	0.938	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 7 Proteins, and 95% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
17	482537.XP_008567268.1	0.937	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon
18	482537.XP_008573994.1	0.937	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 25 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
19	482537.XP_008590587.1	0.925	BRCA1-associated RING domain protein 1 isoform X1
20	482537.XP_008580937.1	0.921	E3 ubiquitin-protein ligase TRIP12 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061631	0.921	ubiquitin conjugating enzyme activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0044238	0.997	primary metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:1901564	0.987	organonitrogen compound metabolic process
GO:0044248	0.976	cellular catabolic process
GO:0009057	0.975	macromolecule catabolic process
GO:0019538	0.973	protein metabolic process
GO:0043632	0.966	modification-dependent macromolecule catabolic process
GO:0006511	0.962	ubiquitin-dependent protein catabolic process
GO:0065007	0.773	biological regulation
GO:0050789	0.763	regulation of biological process
GO:0032446	0.733	protein modification by small protein conjugation
GO:0050794	0.695	regulation of cellular process
GO:0016567	0.693	protein ubiquitination
GO:0050896	0.376	response to stimulus
GO:0019222	0.330	regulation of metabolic process
GO:0048519	0.309	negative regulation of biological process
GO:0060255	0.302	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.998	nucleus
GO:0005829	0.986	cytosol
GO:0070013	0.983	intracellular organelle lumen
GO:0032991	0.978	protein-containing complex
GO:0005654	0.931	nucleoplasm
GO:1902494	0.429	catalytic complex
GO:0140535	0.371	intracellular protein-containing complex
GO:1990234	0.328	transferase complex
GO:0000151	0.321	ubiquitin ligase complex
GO:0031982	0.304	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.
EC:2.3.2.23	0.921	E2 ubiquitin-conjugating enzyme.

[back to server]