StarFunc result for job id P61086

User Input

>input (200 residues)
MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEI
KIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAA
EPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVI
VALSSKSWDVETATELLLSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZXS8	1.000	1.000	6.857E-40	200	1.000	1.000	D3ZXS8.pdb.gz	D3ZXS8_RAT Ubiquitin-conjugating enzyme E2K OS=Rattus norvegicus OX=10116 GN=Ube2k PE=4 SV=2
2	AFDB:P61085	1.000	1.000	1.664E-39	200	1.000	1.000	P61085.pdb.gz	UBE2K_BOVIN Ubiquitin-conjugating enzyme E2 K OS=Bos taurus OX=9913 GN=UBE2K PE=1 SV=3
3	PDB:3e46A	0.998	0.988	1.859E-37	202	0.995	0.985	3e46A.pdb.gz
4	AFDB:P52486	0.975	0.980	5.254E-30	199	0.675	0.678	P52486.pdb.gz	UBCD4_DROME Ubiquitin-conjugating enzyme E2-22 kDa OS=Drosophila melanogaster OX=7227 GN=Ubc4 PE=1 SV=2
5	AFDB:F4KAG5	0.710	0.700	1.754E-21	203	0.470	0.463	F4KAG5.pdb.gz	F4KAG5_ARATH E2 ubiquitin-conjugating enzyme OS=Arabidopsis thaliana OX=3702 GN=UBC27 PE=1 SV=1
6	AFDB:O74810	0.734	0.678	2.661E-20	217	0.425	0.392	O74810.pdb.gz	UBC1_SCHPO Ubiquitin-conjugating enzyme E2 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc1 PE=3 SV=2
7	AFDB:P21734	0.738	0.689	2.823E-20	215	0.405	0.377	P21734.pdb.gz	UBC1_YEAST Ubiquitin-conjugating enzyme E2 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC1 PE=1 SV=1
8	AFDB:A0A1D8PQD4	0.748	0.649	3.576E-20	232	0.450	0.388	A0A1D8PQD4.pdb.gz	A0A1D8PQD4_CANAL E2 ubiquitin-conjugating enzyme OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C604280WA PE=3 SV=1
9	AFDB:A5PKP9	0.705	0.952	3.839E-16	147	0.315	0.429	A5PKP9.pdb.gz	UB2D4_XENLA Ubiquitin-conjugating enzyme E2 D4 OS=Xenopus laevis OX=8355 GN=ube2d4 PE=1 SV=1
10	AFDB:Q8I607	0.706	0.953	4.073E-16	147	0.325	0.442	Q8I607.pdb.gz	Q8I607_PLAF7 Ubiquitin-conjugating enzyme E2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1203900 PE=3 SV=1
11	AFDB:Q803J2	0.689	0.884	6.160E-16	154	0.345	0.448	Q803J2.pdb.gz	Q803J2_DANRE Ube2n protein OS=Danio rerio OX=7955 GN=ube2n PE=1 SV=1
12	PDB:7bbdC	0.707	0.914	1.390E-15	153	0.350	0.458	7bbdC.pdb.gz	RING domains act as both substrate and enzyme in a catalytic arrangement to drive self-anchored ubiquitination.
13	PDB:4ddgA	0.704	0.360	1.565E-15	399	0.305	0.153	4ddgA.pdb.gz
14	PDB:6xodA	0.722	0.929	1.761E-15	154	0.295	0.383	6xodA.pdb.gz
15	PDB:5aieB	0.714	0.944	2.103E-15	150	0.325	0.433	5aieB.pdb.gz	Architecture of the Ubiquitylation Module of the Yeast Ccr4-not Complex.
16	PDB:3bzhA	0.684	0.844	2.999E-15	161	0.305	0.379	3bzhA.pdb.gz
17	PDB:3ptfA	0.720	0.934	6.466E-15	153	0.305	0.399	3ptfA.pdb.gz
18	PDB:4x57C	0.711	0.947	8.191E-15	149	0.325	0.436	4x57C.pdb.gz
19	PDB:4ii2C	0.705	0.938	1.767E-14	149	0.320	0.430	4ii2C.pdb.gz	Structure of a ubiquitin E1-E2 complex: insights to E1-E2 thioester transfer.
20	PDB:4ccgA	0.697	0.880	3.591E-14	157	0.295	0.376	4ccgA.pdb.gz	Structure of the Human Fancl Ring-Ube2T Complex Reveals Determinants of Cognate E3-E2 Selection.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61085	1.59e-149	414	200	1.000	1.000	UBE2K_BOVIN Ubiquitin-conjugating enzyme E2 K OS=Bos taurus OX=9913 GN=UBE2K PE=1 SV=3
2	P61086	1.59e-149	414	200	1.000	1.000	UBE2K_HUMAN Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens OX=9606 GN=UBE2K PE=1 SV=3
3	P61087	1.59e-149	414	200	1.000	1.000	UBE2K_MOUSE Ubiquitin-conjugating enzyme E2 K OS=Mus musculus OX=10090 GN=Ube2k PE=1 SV=3
4	P52486	9.08e-90	263	199	0.680	0.683	UBCD4_DROME Ubiquitin-conjugating enzyme E2-22 kDa OS=Drosophila melanogaster OX=7227 GN=Ubc4 PE=1 SV=2
5	F4KAG5	1.92e-56	179	203	0.485	0.478	F4KAG5_ARATH E2 ubiquitin-conjugating enzyme OS=Arabidopsis thaliana OX=3702 GN=UBC27 PE=1 SV=1
6	P21734	2.88e-50	164	215	0.415	0.386	UBC1_YEAST Ubiquitin-conjugating enzyme E2 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC1 PE=1 SV=1
7	O74810	4.97e-48	158	217	0.420	0.387	UBC1_SCHPO Ubiquitin-conjugating enzyme E2 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc1 PE=3 SV=2
8	D3ZXS8	5.26e-47	152	139	0.360	0.518	D3ZXS8_RAT Ubiquitin-conjugating enzyme E2K OS=Rattus norvegicus OX=10116 GN=Ube2k PE=4 SV=2
9	A0A1D8PQD4	1.25e-44	150	232	0.395	0.341	A0A1D8PQD4_CANAL E2 ubiquitin-conjugating enzyme OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C604280WA PE=3 SV=1
10	Q803J2	3.57e-40	136	154	0.320	0.416	Q803J2_DANRE Ube2n protein OS=Danio rerio OX=7955 GN=ube2n PE=1 SV=1
11	Q9EQX9	2.04e-39	134	152	0.330	0.434	UBE2N_RAT Ubiquitin-conjugating enzyme E2 N OS=Rattus norvegicus OX=10116 GN=Ube2n PE=1 SV=1
12	P61088	2.59e-39	134	152	0.330	0.434	UBE2N_HUMAN Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens OX=9606 GN=UBE2N PE=1 SV=1
13	P61089	2.59e-39	134	152	0.330	0.434	UBE2N_MOUSE Ubiquitin-conjugating enzyme E2 N OS=Mus musculus OX=10090 GN=Ube2n PE=1 SV=1
14	V9HW41	2.59e-39	134	152	0.330	0.434	V9HW41_HUMAN Epididymis secretory protein Li 71 OS=Homo sapiens OX=9606 GN=HEL-S-71 PE=2 SV=1
15	Q5F405	4.60e-39	133	152	0.315	0.414	Q5F405_CHICK UBC core domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_3o20 PE=2 SV=1
16	Q8S920	8.48e-39	132	147	0.335	0.456	UBC5A_ORYSJ Ubiquitin-conjugating enzyme E2 5A OS=Oryza sativa subsp. japonica OX=39947 GN=UBC5A PE=2 SV=1
17	Q6FV50	2.48e-38	131	147	0.330	0.449	Q6FV50_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0E04752g PE=3 SV=1
18	F4I615	6.30e-38	130	162	0.340	0.420	F4I615_ARATH Ubiquitin-conjugating enzyme 36 OS=Arabidopsis thaliana OX=3702 GN=UBC36 PE=1 SV=1
19	Q94A97	2.38e-37	129	153	0.345	0.451	UBC35_ARATH Ubiquitin-conjugating enzyme E2 35 OS=Arabidopsis thaliana OX=3702 GN=UBC35 PE=1 SV=1
20	P35134	2.97e-37	128	148	0.320	0.432	UBC11_ARATH Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana OX=3702 GN=UBC11 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05773 RWD	8.6	18.1	RWD domain
2	PF00627 UBA	2.1e-07	42.0	UBA/TS-N domain
3	PF09288 UBA_3	3.1e+02	12.6	Fungal ubiquitin-associated domain
4	PF05743 UEV	2.5e+02	12.9	UEV domain
5	PF08694 UFC1	3.8e+02	12.1	Ubiquitin-fold modifier-conjugating enzyme 1
6	PF00179 UQ_con	2.6e-42	155.3	Ubiquitin-conjugating enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008564149.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008579441.1	0.980	SUMO-conjugating enzyme UBC9 isoform X1
2	482537.XP_008577062.1	0.976	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 mRNAs, 30 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
3	482537.XP_008588846.1	0.960	ubiquitin-60S ribosomal protein L40
4	482537.XP_008574519.1	0.956	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
5	482537.XP_008585571.1	0.953	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 16 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
6	482537.XP_008573219.1	0.951	Ubiquitin-like modifier-activating enzyme 1 isoform X1
7	482537.XP_008591407.1	0.951	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
8	482537.XP_008569023.1	0.947	polyubiquitin-B
9	482537.XP_008572510.1	0.947	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 mRNAs, 106 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
10	482537.XP_008590170.1	0.946	Ubiquitin-conjugating enzyme E2 variant 2
11	482537.XP_008569771.1	0.911	Ubiquitin-like modifier-activating enzyme 7
12	482537.XP_008591085.1	0.909	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
13	482537.XP_008578367.1	0.892	Ubiquitin-conjugating enzyme E2 D1 isoform X1
14	482537.XP_008579069.1	0.878	Ubiquitin-conjugating enzyme E2 D3 isoform X1
15	482537.XP_008570070.1	0.876	Ubiquitin-conjugating enzyme E2 variant 1 isoform X1
16	482537.XP_008583987.1	0.874	E3 ubiquitin-protein ligase Mdm2 isoform X1
17	482537.XP_008576193.1	0.858	Huntingtin isoform X1
18	482537.XP_008577130.1	0.858	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
19	482537.XP_008585788.1	0.847	Ubiquitin-conjugating enzyme E2 D2-like
20	482537.XP_008588120.1	0.835	Ubiquitin-conjugating enzyme E2 N

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061631	0.970	ubiquitin conjugating enzyme activity
GO:0019899	0.918	enzyme binding
GO:0044389	0.588	ubiquitin-like protein ligase binding
GO:0031625	0.533	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.993	regulation of biological process
GO:0009987	0.969	cellular process
GO:0050794	0.963	regulation of cellular process
GO:0071704	0.962	organic substance metabolic process
GO:0044238	0.945	primary metabolic process
GO:0006807	0.933	nitrogen compound metabolic process
GO:0043170	0.932	macromolecule metabolic process
GO:0019222	0.869	regulation of metabolic process
GO:0051171	0.859	regulation of nitrogen compound metabolic process
GO:1901564	0.856	organonitrogen compound metabolic process
GO:0080090	0.856	regulation of primary metabolic process
GO:0019538	0.851	protein metabolic process
GO:0060255	0.840	regulation of macromolecule metabolic process
GO:0051246	0.815	regulation of protein metabolic process
GO:0044237	0.719	cellular metabolic process
GO:0044260	0.699	cellular macromolecule metabolic process
GO:0006511	0.679	ubiquitin-dependent protein catabolic process
GO:0043412	0.620	macromolecule modification
GO:0031323	0.610	regulation of cellular metabolic process
GO:0032446	0.596	protein modification by small protein conjugation
GO:0050896	0.586	response to stimulus
GO:0048518	0.509	positive regulation of biological process
GO:0048522	0.423	positive regulation of cellular process
GO:0016567	0.397	protein ubiquitination
GO:0051716	0.339	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.975	cytosol
GO:0043231	0.947	intracellular membrane-bounded organelle
GO:0005634	0.918	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.
EC:2.3.2.23	0.970	E2 ubiquitin-conjugating enzyme.

[back to server]