StarFunc result for job id P61088

User Input

>input (152 residues)
MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPE
EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP
LANDVAEQWKTNEAQAIETARAWTRLYAMNNI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q803J2	0.994	0.981	2.728E-29	154	0.980	0.968	Q803J2.pdb.gz	Q803J2_DANRE Ube2n protein OS=Danio rerio OX=7955 GN=ube2n PE=1 SV=1
2	PDB:7bbdC	0.991	0.984	2.153E-28	153	0.987	0.980	7bbdC.pdb.gz	RING domains act as both substrate and enzyme in a catalytic arrangement to drive self-anchored ubiquitination.
3	AFDB:Q5JXB2	0.985	0.978	2.146E-27	153	0.921	0.915	Q5JXB2.pdb.gz	UE2NL_HUMAN Putative ubiquitin-conjugating enzyme E2 N-like OS=Homo sapiens OX=9606 GN=UBE2NL PE=1 SV=1
4	AFDB:Q95XX0	0.966	0.972	2.735E-27	151	0.868	0.874	Q95XX0.pdb.gz	UBC13_CAEEL Ubiquitin-conjugating enzyme E2 13 OS=Caenorhabditis elegans OX=6239 GN=ubc-13 PE=1 SV=2
5	AFDB:P35128	0.987	0.993	1.103E-26	151	0.796	0.801	P35128.pdb.gz	UBE2N_DROME Ubiquitin-conjugating enzyme E2 N OS=Drosophila melanogaster OX=7227 GN=ben PE=1 SV=1
6	AFDB:P52490	0.989	0.983	4.192E-25	153	0.684	0.680	P52490.pdb.gz	UBC13_YEAST Ubiquitin-conjugating enzyme E2 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC13 PE=1 SV=1
7	AFDB:F4I615	0.956	0.897	1.327E-24	162	0.789	0.741	F4I615.pdb.gz	F4I615_ARATH Ubiquitin-conjugating enzyme 36 OS=Arabidopsis thaliana OX=3702 GN=UBC36 PE=1 SV=1
8	AFDB:O13685	0.963	0.989	1.500E-23	148	0.664	0.682	O13685.pdb.gz	UBC13_SCHPO Ubiquitin-conjugating enzyme E2 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc13 PE=1 SV=1
9	AFDB:Q38EF6	0.965	0.978	7.708E-23	150	0.625	0.633	Q38EF6.pdb.gz	Q38EF6_TRYB2 Ubiquitin-conjugating enzyme E2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0050 PE=3 SV=1
10	PDB:6zhtB	0.946	0.940	1.511E-21	153	0.684	0.680	6zhtB.pdb.gz
11	AFDB:Q9SLE4	0.925	0.949	2.449E-19	148	0.441	0.453	Q9SLE4.pdb.gz	UBC29_ARATH Ubiquitin-conjugating enzyme E2 29 OS=Arabidopsis thaliana OX=3702 GN=UBC29 PE=2 SV=1
12	AFDB:A5PKP9	0.921	0.952	7.751E-19	147	0.447	0.463	A5PKP9.pdb.gz	UB2D4_XENLA Ubiquitin-conjugating enzyme E2 D4 OS=Xenopus laevis OX=8355 GN=ube2d4 PE=1 SV=1
13	PDB:3bzhA	0.920	0.870	1.428E-18	161	0.447	0.422	3bzhA.pdb.gz
14	PDB:3ptfA	0.923	0.917	3.767E-18	153	0.434	0.431	3ptfA.pdb.gz
15	PDB:4x57C	0.932	0.950	9.353E-18	149	0.447	0.456	4x57C.pdb.gz
16	PDB:4ccgA	0.894	0.867	9.937E-18	157	0.441	0.427	4ccgA.pdb.gz	Structure of the Human Fancl Ring-Ube2T Complex Reveals Determinants of Cognate E3-E2 Selection.
17	PDB:5aieB	0.924	0.936	4.524E-17	150	0.447	0.453	5aieB.pdb.gz	Architecture of the Ubiquitylation Module of the Yeast Ccr4-not Complex.
18	PDB:4ddgA	0.906	0.356	5.108E-17	399	0.441	0.168	4ddgA.pdb.gz
19	PDB:4ii2C	0.911	0.929	6.510E-17	149	0.447	0.456	4ii2C.pdb.gz	Structure of a ubiquitin E1-E2 complex: insights to E1-E2 thioester transfer.
20	PDB:3e46A	0.917	0.695	2.789E-16	202	0.461	0.347	3e46A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61088	2.74e-111	314	152	1.000	1.000	UBE2N_HUMAN Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens OX=9606 GN=UBE2N PE=1 SV=1
2	P61089	2.74e-111	314	152	1.000	1.000	UBE2N_MOUSE Ubiquitin-conjugating enzyme E2 N OS=Mus musculus OX=10090 GN=Ube2n PE=1 SV=1
3	V9HW41	2.74e-111	314	152	1.000	1.000	V9HW41_HUMAN Epididymis secretory protein Li 71 OS=Homo sapiens OX=9606 GN=HEL-S-71 PE=2 SV=1
4	Q9EQX9	8.87e-111	312	152	0.993	0.993	UBE2N_RAT Ubiquitin-conjugating enzyme E2 N OS=Rattus norvegicus OX=10116 GN=Ube2n PE=1 SV=1
5	Q5F405	3.24e-110	311	152	0.993	0.993	Q5F405_CHICK UBC core domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_3o20 PE=2 SV=1
6	Q803J2	8.65e-109	308	154	0.980	0.968	Q803J2_DANRE Ube2n protein OS=Danio rerio OX=7955 GN=ube2n PE=1 SV=1
7	Q5JXB2	1.12e-98	282	153	0.921	0.915	UE2NL_HUMAN Putative ubiquitin-conjugating enzyme E2 N-like OS=Homo sapiens OX=9606 GN=UBE2NL PE=1 SV=1
8	Q95XX0	8.83e-95	272	151	0.868	0.874	UBC13_CAEEL Ubiquitin-conjugating enzyme E2 13 OS=Caenorhabditis elegans OX=6239 GN=ubc-13 PE=1 SV=2
9	P35128	1.29e-91	264	151	0.796	0.801	UBE2N_DROME Ubiquitin-conjugating enzyme E2 N OS=Drosophila melanogaster OX=7227 GN=ben PE=1 SV=1
10	Q94A97	3.62e-88	255	153	0.770	0.765	UBC35_ARATH Ubiquitin-conjugating enzyme E2 35 OS=Arabidopsis thaliana OX=3702 GN=UBC35 PE=1 SV=1
11	F4I615	1.87e-85	249	162	0.776	0.728	F4I615_ARATH Ubiquitin-conjugating enzyme 36 OS=Arabidopsis thaliana OX=3702 GN=UBC36 PE=1 SV=1
12	P52490	2.91e-77	228	153	0.684	0.680	UBC13_YEAST Ubiquitin-conjugating enzyme E2 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC13 PE=1 SV=1
13	O13685	5.83e-71	212	148	0.664	0.682	UBC13_SCHPO Ubiquitin-conjugating enzyme E2 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc13 PE=1 SV=1
14	Q38EF6	4.91e-67	202	150	0.618	0.627	Q38EF6_TRYB2 Ubiquitin-conjugating enzyme E2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0050 PE=3 SV=1
15	F8VSD4	2.83e-66	198	105	0.691	1.000	F8VSD4_HUMAN Ubiquitin conjugating enzyme E2 N OS=Homo sapiens OX=9606 GN=UBE2N PE=1 SV=1
16	F8VV71	1.94e-65	198	152	0.691	0.691	F8VV71_HUMAN Ubiquitin conjugating enzyme E2 N OS=Homo sapiens OX=9606 GN=UBE2N PE=1 SV=1
17	Q84K93	1.13e-45	147	148	0.454	0.466	Q84K93_GOSHI Ubiquitin-conjugating enzyme E2 OS=Gossypium hirsutum OX=3635 GN=UBC2 PE=2 SV=1
18	P35134	1.55e-45	147	148	0.447	0.459	UBC11_ARATH Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana OX=3702 GN=UBC11 PE=1 SV=2
19	Q8S920	6.01e-45	146	147	0.454	0.469	UBC5A_ORYSJ Ubiquitin-conjugating enzyme E2 5A OS=Oryza sativa subsp. japonica OX=39947 GN=UBC5A PE=2 SV=1
20	Q8S919	8.88e-45	145	148	0.441	0.453	UBC5B_ORYSJ Ubiquitin-conjugating enzyme E2 5B OS=Oryza sativa subsp. japonica OX=39947 GN=UBC5B PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05773 RWD	68	15.2	RWD domain
2	PF05743 UEV	14	17.0	UEV domain
3	PF00179 UQ_con	3.4e-44	161.3	Ubiquitin-conjugating enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008822026.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008850608.1	0.985	TNF receptor-associated factor 6
2	1026970.XP_008854352.1	0.981	STIP1 homology and U-box containing protein 1
3	1026970.XP_008837193.1	0.968	OTU deubiquitinase, ubiquitin aldehyde binding 1
4	1026970.XP_008821230.1	0.959	Ribosomal protein S27a
5	1026970.XP_008838276.1	0.959	E3 ubiquitin-protein ligase RNF8
6	1026970.XP_008832106.1	0.946	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
7	1026970.XP_008839809.1	0.946	Ubiquitin-conjugating enzyme E2 variant 2-like
8	1026970.XP_008822307.1	0.940	Ubiquitin like modifier activating enzyme 1
9	1026970.XP_008828711.1	0.932	Uncharacterized protein LOC103731980
10	1026970.XP_008846264.1	0.929	Helicase like transcription factor
11	1026970.XP_008824716.1	0.925	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: added 69 bases not found in genome assembly
12	1026970.XP_008822760.1	0.914	ubiquitin-60S ribosomal protein L40
13	1026970.XP_008826147.1	0.911	Ubiquitin-conjugating enzyme E2 B
14	1026970.XP_008842255.1	0.905	Ubiquitin-conjugating enzyme E2 A isoform X1
15	1026970.XP_008827829.1	0.896	Inhibitor of nuclear factor kappa B kinase subunit gamma
16	1026970.XP_008852047.1	0.890	Ubiquitin like modifier activating enzyme 6
17	1026970.XP_008833385.1	0.888	Ubiquitin-conjugating enzyme E2 variant 1 isoform X1
18	1026970.XP_008822056.1	0.870	Ring finger protein 40
19	1026970.XP_008842681.1	0.866	Thyroid hormone receptor interactor 12
20	1026970.XP_008825428.1	0.864	E3 ubiquitin-protein ligase parkin-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061631	0.953	ubiquitin conjugating enzyme activity
GO:0019899	0.563	enzyme binding
GO:0031625	0.372	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0043170	0.997	macromolecule metabolic process
GO:0036211	0.990	protein modification process
GO:0070647	0.980	protein modification by small protein conjugation or removal
GO:0009987	0.968	cellular process
GO:0016567	0.955	protein ubiquitination
GO:0044237	0.827	cellular metabolic process
GO:0050789	0.809	regulation of biological process
GO:0050896	0.720	response to stimulus
GO:0044260	0.689	cellular macromolecule metabolic process
GO:0050794	0.680	regulation of cellular process
GO:0006508	0.559	proteolysis
GO:0051716	0.496	cellular response to stimulus
GO:0019222	0.494	regulation of metabolic process
GO:0060255	0.478	regulation of macromolecule metabolic process
GO:0048518	0.472	positive regulation of biological process
GO:0009057	0.457	macromolecule catabolic process
GO:0030163	0.434	protein catabolic process
GO:0043632	0.421	modification-dependent macromolecule catabolic process
GO:0051603	0.375	proteolysis involved in protein catabolic process
GO:0019941	0.372	modification-dependent protein catabolic process
GO:0006950	0.367	response to stress
GO:0080090	0.367	regulation of primary metabolic process
GO:0051171	0.355	regulation of nitrogen compound metabolic process
GO:0006511	0.324	ubiquitin-dependent protein catabolic process
GO:0009893	0.312	positive regulation of metabolic process
GO:0033554	0.300	cellular response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0043232	0.975	intracellular non-membrane-bounded organelle
GO:0032991	0.972	protein-containing complex
GO:0005829	0.966	cytosol
GO:0140535	0.959	intracellular protein-containing complex
GO:1902494	0.952	catalytic complex
GO:1990234	0.907	transferase complex
GO:0031982	0.776	vesicle
GO:0031371	0.774	ubiquitin conjugating enzyme complex
GO:0005730	0.675	nucleolus
GO:0001650	0.674	fibrillar center
GO:0005576	0.437	extracellular region
GO:0070062	0.417	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.
EC:2.3.2.23	0.953	E2 ubiquitin-conjugating enzyme.

[back to server]