StarFunc result for job id P61158

User Input

>input (418 residues)
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDF
FIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTP
ENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVK
EFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVV
DEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKP
KPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61157	0.999	0.999	2.288E-85	418	1.000	1.000	P61157.pdb.gz	ARP3_BOVIN Actin-related protein 3 OS=Bos taurus OX=9913 GN=ACTR3 PE=1 SV=3
2	AFDB:P32392	0.979	0.979	2.236E-74	418	0.806	0.806	P32392.pdb.gz	ARP3_DROME Actin-related protein 3 OS=Drosophila melanogaster OX=7227 GN=Arp3 PE=2 SV=3
3	AFDB:Q9N4I0	0.979	0.963	2.054E-70	425	0.761	0.748	Q9N4I0.pdb.gz	ARP3_CAEEL Actin-related protein 3 OS=Caenorhabditis elegans OX=6239 GN=arx-1 PE=1 SV=1
4	AFDB:P42528	0.963	0.963	1.675E-65	418	0.684	0.684	P42528.pdb.gz	ARP3_DICDI Actin-related protein 3 OS=Dictyostelium discoideum OX=44689 GN=arpC PE=1 SV=1
5	AFDB:Q9SAF1	0.947	0.927	8.311E-62	427	0.584	0.571	Q9SAF1.pdb.gz	ARP3_ARATH Actin-related protein 3 OS=Arabidopsis thaliana OX=3702 GN=ARP3 PE=1 SV=1
6	AFDB:Q59Z11	0.932	0.929	4.425E-60	419	0.615	0.613	Q59Z11.pdb.gz	Q59Z11_CANAL Actin-related protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARP3 PE=3 SV=1
7	AFDB:P32390	0.940	0.921	2.373E-59	427	0.603	0.590	P32390.pdb.gz	ARP3_SCHPO Actin-related protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=act2 PE=1 SV=1
8	AFDB:P47117	0.916	0.854	2.373E-59	449	0.627	0.584	P47117.pdb.gz	ARP3_YEAST Actin-related protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARP3 PE=1 SV=1
9	PDB:7aqka	0.855	0.855	3.733E-59	418	1.000	1.000	7aqka.pdb.gz
10	PDB:3dwlA	0.782	0.914	2.736E-47	355	0.560	0.659	3dwlA.pdb.gz	Structure and biochemical properties of fission yeast arp2/3 complex lacking the arp2 subunit.
11	PDB:6w17A	0.838	0.919	4.221E-45	380	0.589	0.647	6w17A.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.
12	AFDB:Q9U1E8	0.803	0.889	1.654E-40	376	0.337	0.375	Q9U1E8.pdb.gz	Q9U1E8_LEIMA Actin OS=Leishmania major OX=5664 GN=ACT PE=3 SV=1
13	PDB:1yagA	0.805	0.901	1.663E-40	372	0.337	0.379	1yagA.pdb.gz	The structure of nonvertebrate actin: Implications for the ATP hydrolytic mechanism
14	AFDB:P07829	0.802	0.888	2.448E-40	376	0.349	0.388	P07829.pdb.gz	ACT3_DICDI Actin-3 OS=Dictyostelium discoideum OX=44689 GN=act3 PE=3 SV=3
15	PDB:4cbxA	0.806	0.937	1.055E-39	358	0.344	0.402	4cbxA.pdb.gz	Structural Differences Explain Diverse Functions of Plasmodium Actins.
16	PDB:1c0gA	0.811	0.918	2.443E-39	368	0.340	0.386	1c0gA.pdb.gz	Structural basis for the higher Ca(2+)-activation of the regulated actin-activated myosin ATPase observed with Dictyostelium/Tetrahymena actin chimeras.
17	PDB:6tu4A	0.767	0.855	4.748E-38	372	0.342	0.384	6tu4A.pdb.gz	High-resolution structures of malaria parasite actomyosin and actin filaments.
18	PDB:4pl7A	0.774	0.844	6.875E-35	382	0.328	0.359	4pl7A.pdb.gz	Structural basis of thymosin-beta 4/profilin exchange leading to actin filament polymerization.
19	PDB:4a7fA	0.742	0.819	4.268E-31	375	0.349	0.389	4a7fA.pdb.gz	Structure of the Rigor Actin-Tropomyosin-Myosin Complex.
20	PDB:6w18B	0.739	0.836	1.136E-26	367	0.306	0.349	6w18B.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P32392	0.0	715	418	0.806	0.806	ARP3_DROME Actin-related protein 3 OS=Drosophila melanogaster OX=7227 GN=Arp3 PE=2 SV=3
2	P42528	0.0	584	418	0.687	0.687	ARP3_DICDI Actin-related protein 3 OS=Dictyostelium discoideum OX=44689 GN=arpC PE=1 SV=1
3	P61157	0.0	868	418	1.000	1.000	ARP3_BOVIN Actin-related protein 3 OS=Bos taurus OX=9913 GN=ACTR3 PE=1 SV=3
4	P61158	0.0	868	418	1.000	1.000	ARP3_HUMAN Actin-related protein 3 OS=Homo sapiens OX=9606 GN=ACTR3 PE=1 SV=3
5	Q4V7C7	0.0	868	418	0.998	0.998	ARP3_RAT Actin-related protein 3 OS=Rattus norvegicus OX=10116 GN=Actr3 PE=1 SV=1
6	Q801P7	0.0	851	418	0.969	0.969	ARP3A_XENLA Actin-related protein 3-A OS=Xenopus laevis OX=8355 GN=actr3-a PE=1 SV=1
7	Q99JY9	0.0	868	418	0.998	0.998	ARP3_MOUSE Actin-related protein 3 OS=Mus musculus OX=10090 GN=Actr3 PE=1 SV=3
8	Q9N4I0	0.0	676	425	0.770	0.758	ARP3_CAEEL Actin-related protein 3 OS=Caenorhabditis elegans OX=6239 GN=arx-1 PE=1 SV=1
9	Q9P1U1	0.0	786	418	0.907	0.907	ARP3B_HUMAN Actin-related protein 3B OS=Homo sapiens OX=9606 GN=ACTR3B PE=2 SV=1
10	Q9SAF1	0.0	518	427	0.598	0.585	ARP3_ARATH Actin-related protein 3 OS=Arabidopsis thaliana OX=3702 GN=ARP3 PE=1 SV=1
11	Q59Z11	4.54e-174	494	419	0.612	0.611	Q59Z11_CANAL Actin-related protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARP3 PE=3 SV=1
12	P32390	1.61e-171	488	427	0.600	0.588	ARP3_SCHPO Actin-related protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=act2 PE=1 SV=1
13	P47117	6.90e-170	485	449	0.627	0.584	ARP3_YEAST Actin-related protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARP3 PE=1 SV=1
14	Q9C0K3	3.20e-112	329	210	0.402	0.800	ARP3C_HUMAN Actin-related protein 3C OS=Homo sapiens OX=9606 GN=ACTR3C PE=2 SV=1
15	P86287	8.86e-84	263	376	0.373	0.415	ACT1_PLAFX Actin-1 OS=Plasmodium falciparum (isolate HB3) OX=137071 GN=ACT1 PE=1 SV=1
16	Q8I4X0	8.86e-84	263	376	0.373	0.415	ACT1_PLAF7 Actin-1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=ACT1 PE=1 SV=1
17	Q4Z1L3	1.14e-83	262	376	0.371	0.412	ACT1_PLABA Actin-1 OS=Plasmodium berghei (strain Anka) OX=5823 GN=ACT1 PE=1 SV=2
18	P60009	1.22e-81	257	375	0.354	0.395	ACT_CANGA Actin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ACT1 PE=3 SV=1
19	P60010	1.22e-81	257	375	0.354	0.395	ACT_YEAST Actin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACT1 PE=1 SV=1
20	P07829	1.85e-81	257	376	0.364	0.404	ACT3_DICDI Actin-3 OS=Dictyostelium discoideum OX=44689 GN=act3 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00022 Actin	1e-83	292.8	Actin
2	PF17989 ALP_N	79	15.0	Actin like proteins N terminal domain
3	PF06723 MreB_Mbl	0.2	22.0	MreB/Mbl protein
4	PF03259 Robl_LC7	2.4e+02	12.9	Roadblock/LC7 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010604517.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010608032.1	0.997	ATP-binding component of the Arp2/3 complex, a multiprotein complex that mediates actin polymerization upon stimulation by nucleation-promoting factor (NPF). The Arp2/3 complex mediates the formation of branched actin networks in the cytoplasm, providing the force for cell motility. Seems to contact the pointed end of the daughter actin filament
2	885580.XP_010641034.1	0.996	Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks
3	885580.XP_010610235.1	0.991	Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks
4	885580.XP_010633663.1	0.991	Neural Wiskott-Aldrich syndrome protein
5	885580.XP_010638861.1	0.989	Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Arp2/3 complex plays a critical role in the control of cell morphogenesis via the modulation of cell polarity development
6	885580.XP_010602725.1	0.987	Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks
7	885580.XP_010616700.1	0.981	Actin-related protein 2/3 complex subunit 4
8	885580.XP_010641037.1	0.953	Actin-related protein 2/3 complex subunit 1A
9	885580.XP_010604737.1	0.930	wiskott-Aldrich syndrome protein
10	885580.XP_010611822.1	0.918	Actin-related protein 2/3 complex subunit 5-like protein
11	885580.XP_010634021.1	0.914	Src substrate cortactin
12	885580.XP_010633924.1	0.900	Belongs to the TRAFAC class dynamin-like GTPase superfamily. Dynamin/Fzo/YdjA family
13	885580.XP_010628296.1	0.882	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
14	885580.XP_010613961.1	0.856	NCK-interacting protein with SH3 domain
15	885580.XP_010616920.1	0.854	Actin, cytoplasmic 2
16	885580.XP_010641141.1	0.853	Belongs to the actin family.
17	885580.XP_010630951.1	0.844	wiskott-Aldrich syndrome protein family member 2
18	885580.XP_010624311.1	0.798	Cell division control protein 42 homolog isoform X1
19	885580.XP_010622123.1	0.778	Wiskott-Aldrich syndrome protein family member 3
20	885580.XP_010617492.1	0.775	Protein BRICK1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.688	protein-containing complex binding
GO:0008092	0.678	cytoskeletal protein binding
GO:0003779	0.642	actin binding
GO:0051015	0.385	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0071840	0.985	cellular component organization or biogenesis
GO:0051128	0.980	regulation of cellular component organization
GO:0006996	0.980	organelle organization
GO:0048522	0.978	positive regulation of cellular process
GO:0044087	0.975	regulation of cellular component biogenesis
GO:1902745	0.965	positive regulation of lamellipodium organization
GO:0120034	0.964	positive regulation of plasma membrane bounded cell projection assembly
GO:0030029	0.958	actin filament-based process
GO:0007010	0.956	cytoskeleton organization
GO:0007015	0.942	actin filament organization
GO:0050896	0.872	response to stimulus
GO:0010591	0.863	regulation of lamellipodium assembly
GO:0019222	0.858	regulation of metabolic process
GO:0010592	0.848	positive regulation of lamellipodium assembly
GO:0010638	0.821	positive regulation of organelle organization
GO:0009893	0.773	positive regulation of metabolic process
GO:0060255	0.771	regulation of macromolecule metabolic process
GO:0050793	0.749	regulation of developmental process
GO:0031323	0.731	regulation of cellular metabolic process
GO:0022603	0.726	regulation of anatomical structure morphogenesis
GO:0051171	0.721	regulation of nitrogen compound metabolic process
GO:0010604	0.719	positive regulation of macromolecule metabolic process
GO:0080090	0.718	regulation of primary metabolic process
GO:0051491	0.716	positive regulation of filopodium assembly
GO:0065008	0.707	regulation of biological quality
GO:0050803	0.694	regulation of synapse structure or activity
GO:0051173	0.682	positive regulation of nitrogen compound metabolic process
GO:0031325	0.667	positive regulation of cellular metabolic process
GO:0051716	0.654	cellular response to stimulus
GO:0022607	0.649	cellular component assembly
GO:0050807	0.642	regulation of synapse organization
GO:1903508	0.641	positive regulation of nucleic acid-templated transcription
GO:0010468	0.610	regulation of gene expression
GO:0010975	0.606	regulation of neuron projection development
GO:0032501	0.589	multicellular organismal process
GO:0051239	0.543	regulation of multicellular organismal process
GO:0032502	0.526	developmental process
GO:0009719	0.524	response to endogenous stimulus
GO:0051179	0.493	localization
GO:0042221	0.487	response to chemical
GO:0099175	0.480	regulation of postsynapse organization
GO:0051960	0.477	regulation of nervous system development
GO:0048856	0.473	anatomical structure development
GO:0048519	0.469	negative regulation of biological process
GO:0048523	0.457	negative regulation of cellular process
GO:0070848	0.451	response to growth factor
GO:0051301	0.435	cell division
GO:0120036	0.413	plasma membrane bounded cell projection organization
GO:0045597	0.376	positive regulation of cell differentiation
GO:0006355	0.375	regulation of DNA-templated transcription
GO:0010033	0.364	response to organic substance
GO:0051493	0.315	regulation of cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0005829	0.996	cytosol
GO:0005576	0.995	extracellular region
GO:0031982	0.995	vesicle
GO:0070062	0.993	extracellular exosome
GO:0016020	0.992	membrane
GO:0005856	0.990	cytoskeleton
GO:0032991	0.980	protein-containing complex
GO:0005634	0.976	nucleus
GO:0070161	0.966	anchoring junction
GO:0015629	0.945	actin cytoskeleton
GO:0120025	0.941	plasma membrane bounded cell projection
GO:0031252	0.878	cell leading edge
GO:0030027	0.834	lamellipodium
GO:0005925	0.795	focal adhesion
GO:0005885	0.736	Arp2/3 protein complex
GO:0005886	0.663	plasma membrane
GO:0012505	0.654	endomembrane system
GO:0043233	0.472	organelle lumen
GO:0005694	0.463	chromosome
GO:0099080	0.410	supramolecular complex
GO:0070013	0.382	intracellular organelle lumen
GO:0031981	0.364	nuclear lumen
GO:0097708	0.358	intracellular vesicle
GO:0005911	0.353	cell-cell junction
GO:0031410	0.353	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]