StarFunc result for job id P61218

User Input

>input (127 residues)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIITD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88828	0.690	0.690	2.686E-19	127	0.992	0.992	O88828.pdb.gz	RPAB2_RAT DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Rattus norvegicus OX=10116 GN=Polr2f PE=1 SV=1
2	AFDB:Q24320	0.657	0.637	2.945E-14	131	0.677	0.656	Q24320.pdb.gz	RPAB2_DROME DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Drosophila melanogaster OX=7227 GN=RpII18 PE=2 SV=1
3	AFDB:Q9FJ98	0.629	0.556	8.262E-14	144	0.591	0.521	Q9FJ98.pdb.gz	RPD6A_ARATH DNA-directed RNA polymerases II, IV and V subunit 6A OS=Arabidopsis thaliana OX=3702 GN=NRPB6A PE=1 SV=1
4	AFDB:Q17684	0.652	0.609	1.216E-13	137	0.598	0.555	Q17684.pdb.gz	RPAB2_CAEEL Probable DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Caenorhabditis elegans OX=6239 GN=rpb-6 PE=3 SV=1
5	AFDB:P20435	0.618	0.507	1.410E-12	155	0.488	0.400	P20435.pdb.gz	RPAB2_YEAST DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPO26 PE=1 SV=1
6	AFDB:P36595	0.604	0.541	1.824E-12	142	0.591	0.528	P36595.pdb.gz	RPAB2_SCHPO DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpb6 PE=1 SV=1
7	PDB:7zs9F	0.609	0.655	2.329E-12	118	0.535	0.576	7zs9F.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
8	PDB:1qklA	0.489	0.489	5.743E-12	127	1.000	1.000	1qklA.pdb.gz
9	PDB:3h0gF	0.597	0.904	1.833E-11	83	0.472	0.723	3h0gF.pdb.gz	Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
10	AFDB:Q585J9	0.679	0.603	3.112E-11	144	0.472	0.417	Q585J9.pdb.gz	Q585J9_TRYB2 DNA-directed RNA polymerase subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.26G5.250 PE=3 SV=1
11	PDB:7eu1F	0.587	0.950	1.045E-10	77	0.472	0.779	7eu1F.pdb.gz	Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
12	PDB:6drdF	0.527	0.972	1.065E-9	68	0.535	1.000	6drdF.pdb.gz	Architecture of Pol II(G) and molecular mechanism of transcription regulation by Gdown1.
13	AFDB:B8YB61	0.486	0.643	1.141E-6	95	0.220	0.295	B8YB61.pdb.gz	RPO6_SACSH DNA-directed RNA polymerase subunit Rpo6 OS=Saccharolobus shibatae OX=2286 GN=rpo6 PE=1 SV=1
14	AFDB:Q387N1	0.606	0.589	1.298E-6	131	0.283	0.275	Q387N1.pdb.gz	Q387N1_TRYB2 DNA-directed RNA polymerase subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0935 PE=1 SV=1
15	AFDB:P39463	0.526	0.740	1.679E-6	89	0.213	0.303	P39463.pdb.gz	RPO6_SULAC DNA-directed RNA polymerase subunit Rpo6 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=rpo6 PE=1 SV=2
16	PDB:4aybK	0.465	0.685	5.287E-6	84	0.220	0.333	4aybK.pdb.gz	Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
17	PDB:7ok0K	0.473	0.686	1.483E-5	86	0.213	0.314	7ok0K.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
18	PDB:7o4lF	0.401	0.922	6.969E-5	55	0.307	0.709	7o4lF.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
19	PDB:6yw7B	0.167	0.081	3.937E-1	286	0.071	0.031	6yw7B.pdb.gz	Cryo-EM of human Arp2/3 complexes provides structural insights into actin nucleation modulation by ARPC5 isoforms.
20	PDB:6decI	0.168	0.110	4.777E-1	209	0.071	0.043	6decI.pdb.gz	Structure of the nucleation-promoting factor SPIN90 bound to the actin filament nucleator Arp2/3 complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61218	3.04e-89	256	127	1.000	1.000	RPAB2_HUMAN DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Homo sapiens OX=9606 GN=POLR2F PE=1 SV=1
2	O88828	6.56e-89	255	127	0.992	0.992	RPAB2_RAT DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Rattus norvegicus OX=10116 GN=Polr2f PE=1 SV=1
3	P61219	6.56e-89	255	127	0.992	0.992	RPAB2_MOUSE DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Mus musculus OX=10090 GN=Polr2f PE=2 SV=1
4	U3KQB0	4.05e-84	243	122	0.945	0.984	U3KQB0_HUMAN DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Homo sapiens OX=9606 GN=POLR2F PE=1 SV=1
5	Q24320	6.90e-45	144	131	0.591	0.573	RPAB2_DROME DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Drosophila melanogaster OX=7227 GN=RpII18 PE=2 SV=1
6	P36595	1.95e-40	133	142	0.583	0.521	RPAB2_SCHPO DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpb6 PE=1 SV=1
7	P20435	5.30e-40	132	155	0.559	0.458	RPAB2_YEAST DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPO26 PE=1 SV=1
8	Q9FJ98	5.98e-40	132	144	0.575	0.507	RPD6A_ARATH DNA-directed RNA polymerases II, IV and V subunit 6A OS=Arabidopsis thaliana OX=3702 GN=NRPB6A PE=1 SV=1
9	Q17684	2.19e-39	130	137	0.488	0.453	RPAB2_CAEEL Probable DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Caenorhabditis elegans OX=6239 GN=rpb-6 PE=3 SV=1
10	Q9SJ96	1.93e-38	128	144	0.528	0.465	RPB6B_ARATH DNA-directed RNA polymerases II and V subunit 6B OS=Arabidopsis thaliana OX=3702 GN=NRPB6B PE=1 SV=1
11	Q585J9	9.24e-31	108	144	0.402	0.354	Q585J9_TRYB2 DNA-directed RNA polymerase subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.26G5.250 PE=3 SV=1
12	B8YB61	5.23e-10	54.7	95	0.220	0.295	RPO6_SACSH DNA-directed RNA polymerase subunit Rpo6 OS=Saccharolobus shibatae OX=2286 GN=rpo6 PE=1 SV=1
13	Q97ZJ9	1.44e-09	53.5	95	0.213	0.284	RPO6_SACS2 DNA-directed RNA polymerase subunit Rpo6 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=rpo6 PE=1 SV=1
14	Q387N1	6.60e-08	49.7	131	0.244	0.237	Q387N1_TRYB2 DNA-directed RNA polymerase subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0935 PE=1 SV=1
15	P39463	1.06e-06	45.8	89	0.213	0.303	RPO6_SULAC DNA-directed RNA polymerase subunit Rpo6 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=rpo6 PE=1 SV=2
16	O13836	0.85	31.2	352	0.236	0.085	DXO_SCHPO Decapping nuclease din1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=din1 PE=1 SV=1
17	P43556	1.2	30.8	714	0.142	0.025	RGD2_YEAST Rho-GTPase-activating protein RGD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RGD2 PE=1 SV=1
18	Q7JUF2	2.7	30.0	927	0.173	0.024	Q7JUF2_DROME Diego, isoform A OS=Drosophila melanogaster OX=7227 GN=dgo PE=1 SV=1
19	Q18194	3.5	29.3	413	0.110	0.034	Q18194_CAEEL Dynactin subunit 4 OS=Caenorhabditis elegans OX=6239 GN=dnc-4 PE=1 SV=1
20	Q5KKP4	5.7	28.9	640	0.142	0.028	HSP71_CRYNJ Transcriptional coregulator SSA1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=SSA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01192 RNA_pol_Rpb6	1.3e-09	49.2	RNA polymerase Rpb6

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008849500.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008829775.1	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC4
2	1026970.XP_008831507.1	0.999	DNA-directed RNA polymerase II subunit RPB2
3	1026970.XP_008833112.1	0.999	DNA-directed RNA polymerase II subunit RPB3
4	1026970.XP_008835404.1	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC1
5	1026970.XP_008835730.1	0.999	RNA polymerase II subunit G
6	1026970.XP_008852647.1	0.999	RNA polymerase II subunit L
7	1026970.XP_008854027.1	0.999	RNA polymerase II subunit A
8	1026970.XP_008829529.1	0.998	RNA polymerase II subunit H
9	1026970.XP_008826292.1	0.997	DNA-directed RNA polymerase II subunit RPB9 isoform X1
10	1026970.XP_008827291.1	0.997	DNA-directed RNA polymerases I and III subunit RPAC1 isoform X1
11	1026970.XP_008830505.1	0.997	RNA polymerase II subunit J
12	1026970.XP_008820224.1	0.996	DNA-directed RNA polymerase II subunit RPB4
13	1026970.XP_008826081.1	0.996	Zinc ribbon domain containing 1
14	1026970.XP_008823290.1	0.995	DNA-directed RNA polymerases I and III subunit RPAC2
15	1026970.XP_008830962.1	0.995	TWIST neighbor
16	1026970.XP_008834971.1	0.994	RNA polymerase I subunit A
17	1026970.XP_008848052.1	0.994	RNA polymerase III subunit A
18	1026970.XP_008821917.1	0.992	DNA-directed RNA polymerases I, II, and III subunit RPABC5-like
19	1026970.XP_008843021.1	0.992	DNA-directed RNA polymerase III subunit RPC8 isoform X1
20	1026970.XP_008849005.1	0.989	DNA-directed RNA polymerase III subunit RPC10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003899	1.000	DNA-directed 5'-3' RNA polymerase activity
GO:0005515	0.985	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006351	0.995	DNA-templated transcription
GO:0006366	0.969	transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0140535	0.998	intracellular protein-containing complex
GO:1990234	0.998	transferase complex
GO:0043228	0.995	non-membrane-bounded organelle
GO:0140513	0.994	nuclear protein-containing complex
GO:0005730	0.986	nucleolus
GO:0000428	0.974	DNA-directed RNA polymerase complex
GO:0055029	0.940	nuclear DNA-directed RNA polymerase complex
GO:0016591	0.904	RNA polymerase II, holoenzyme
GO:0005737	0.886	cytoplasm
GO:0005665	0.880	RNA polymerase II, core complex
GO:0005829	0.455	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.6	1.000	DNA-directed RNA polymerase.

[back to server]