StarFunc result for job id P61221

User Input

>input (599 residues)
MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGI
CIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTAL
KILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAA
KGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMF
DEPSSYLDVKQRLKAAITIRSLINPDRYIIVVEHDLSVLDYLSDFICCLYGVPSAYGVVT
MPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEF
ELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKS
TGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPA
DVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPS
KNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6zmeCI	0.940	0.967	0.000	582	0.970	0.998	6zmeCI.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
2	AFDB:P61221	1.000	1.000	0.000	599	1.000	1.000	P61221.pdb.gz	ABCE1_HUMAN ATP-binding cassette sub-family E member 1 OS=Homo sapiens OX=9606 GN=ABCE1 PE=1 SV=1
3	AFDB:Q03195	0.985	0.970	0.000	608	0.691	0.681	Q03195.pdb.gz	RLI1_YEAST Translation initiation factor RLI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RLI1 PE=1 SV=1
4	AFDB:Q8LPJ4	0.983	0.973	0.000	605	0.760	0.752	Q8LPJ4.pdb.gz	AB2E_ARATH ABC transporter E family member 2 OS=Arabidopsis thaliana OX=3702 GN=ABCE2 PE=2 SV=1
5	AFDB:Q8T8P2	0.987	0.981	0.000	603	0.718	0.713	Q8T8P2.pdb.gz	Q8T8P2_DICDI RNaseL inhibitor-like protein OS=Dictyostelium discoideum OX=44689 GN=abcE1 PE=4 SV=1
6	AFDB:Q9VSS1	0.986	0.967	0.000	611	0.771	0.756	Q9VSS1.pdb.gz	ABCE1_DROME Protein Pixie OS=Drosophila melanogaster OX=7227 GN=pix PE=1 SV=1
7	AFDB:O60102	0.967	0.977	9.149E-101	593	0.644	0.651	O60102.pdb.gz	RLI1_SCHPO Translation initiation factor rli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rli1 PE=3 SV=1
8	AFDB:Q38C78	0.961	0.913	1.290E-99	631	0.634	0.602	Q38C78.pdb.gz	Q38C78_TRYB2 Ribonuclease L inhibitor, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6290 PE=4 SV=1
9	PDB:4crmP	0.936	0.923	8.573E-84	608	0.691	0.681	4crmP.pdb.gz	Cryoelectron Microscopic Structures of Eukaryotic Translation Termination Complexes Containing Erf1-Erf3 or Erf1-Abce1.
10	PDB:6zcek	0.749	0.773	2.540E-80	579	0.674	0.698	6zcek.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
11	AFDB:Q980K5	0.945	0.943	5.631E-77	600	0.446	0.445	Q980K5.pdb.gz	Q980K5_SACS2 RNase L inhibitor OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=SSO0287 PE=1 SV=1
12	PDB:6tmfd	0.724	0.743	3.872E-65	582	0.441	0.454	6tmfd.pdb.gz	Molecular analysis of the ribosome recycling factor ABCE1 bound to the 30S post-splitting complex.
13	AFDB:P43672	0.537	0.509	1.009E-22	635	0.179	0.169	P43672.pdb.gz	UUP_ECOLI ATP-binding protein Uup OS=Escherichia coli (strain K12) OX=83333 GN=uup PE=1 SV=2
14	AFDB:Q9FIB4	0.514	0.460	1.582E-22	678	0.177	0.156	Q9FIB4.pdb.gz	AB2F_ARATH ABC transporter F family member 2 OS=Arabidopsis thaliana OX=3702 GN=ABCF2 PE=3 SV=2
15	PDB:7msmx	0.484	0.519	5.266E-20	553	0.175	0.190	7msmx.pdb.gz	Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
16	PDB:2iw3B	0.290	0.188	9.508E-15	980	0.152	0.093	2iw3B.pdb.gz	Structure of Eef3 and the Mechanism of Transfer RNA Release from the E-Site.
17	PDB:3j5sD	0.488	0.522	1.333E-14	554	0.182	0.197	3j5sD.pdb.gz	EttA regulates translation by binding the ribosomal E site and restricting ribosome-tRNA dynamics.
18	PDB:2vf7B	0.414	0.318	1.766E-14	813	0.180	0.133	2vf7B.pdb.gz	Structural and mutational analyses of Deinococcus radiodurans UvrA2 provide insight into DNA binding and damage recognition by UvrAs.
19	PDB:3uwxA	0.436	0.291	3.884E-14	945	0.140	0.089	3uwxA.pdb.gz	Structure and mechanism of the UvrA-UvrB DNA damage sensor.
20	PDB:2vf8B	0.399	0.297	2.786E-13	835	0.167	0.120	2vf8B.pdb.gz	Structural and Mutational Analyses of Deinococcus Radiodurans Uvra2 Provide Insight Into DNA Binding and Damage Recognition by Uvras.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60102	0.0	823	593	0.646	0.653	RLI1_SCHPO Translation initiation factor rli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rli1 PE=3 SV=1
2	P61221	0.0	1239	599	1.000	1.000	ABCE1_HUMAN ATP-binding cassette sub-family E member 1 OS=Homo sapiens OX=9606 GN=ABCE1 PE=1 SV=1
3	Q03195	0.0	878	608	0.693	0.683	RLI1_YEAST Translation initiation factor RLI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RLI1 PE=1 SV=1
4	Q38C78	0.0	829	631	0.636	0.604	Q38C78_TRYB2 Ribonuclease L inhibitor, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6290 PE=4 SV=1
5	Q6SSD8	0.0	1238	599	0.997	0.997	Q6SSD8_CHLAE RNase L inhibitor OS=Chlorocebus aethiops OX=9534 PE=1 SV=1
6	Q8LPJ4	0.0	954	605	0.761	0.754	AB2E_ARATH ABC transporter E family member 2 OS=Arabidopsis thaliana OX=3702 GN=ABCE2 PE=2 SV=1
7	Q8MYK1	0.0	827	631	0.634	0.602	Q8MYK1_9TRYP Putative ribonuclease L inhibitor OS=Trypanosoma brucei OX=5691 GN=RLI PE=4 SV=1
8	Q8T8P2	0.0	905	603	0.718	0.713	Q8T8P2_DICDI RNaseL inhibitor-like protein OS=Dictyostelium discoideum OX=44689 GN=abcE1 PE=4 SV=1
9	Q980K5	0.0	525	600	0.449	0.448	Q980K5_SACS2 RNase L inhibitor OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=SSO0287 PE=1 SV=1
10	Q9VSS1	0.0	991	611	0.771	0.756	ABCE1_DROME Protein Pixie OS=Drosophila melanogaster OX=7227 GN=pix PE=1 SV=1
11	Q8TTZ3	2.41e-15	80.1	348	0.112	0.193	Q8TTZ3_METAC Sulfate/molybdate ABC transporter, ATP-binding protein OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) OX=188937 GN=MA_0282 PE=1 SV=1
12	O14134	1.36e-14	79.7	1057	0.154	0.087	ELF1_SCHPO mRNA export factor elf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=elf1 PE=1 SV=1
13	P0A9W3	3.81e-14	77.8	555	0.207	0.223	ETTA_ECOLI Energy-dependent translational throttle protein EttA OS=Escherichia coli (strain K12) OX=83333 GN=ettA PE=1 SV=2
14	Q9LV93	5.00e-14	77.8	692	0.205	0.178	AB5F_ARATH ABC transporter F family member 5 OS=Arabidopsis thaliana OX=3702 GN=ABCF5 PE=2 SV=1
15	Q9FIB4	5.22e-14	77.4	678	0.210	0.186	AB2F_ARATH ABC transporter F family member 2 OS=Arabidopsis thaliana OX=3702 GN=ABCF2 PE=3 SV=2
16	Q9HT73	1.44e-13	73.6	269	0.085	0.190	ZNUC_PSEAE Zinc import ATP-binding protein ZnuC OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=znuC PE=3 SV=1
17	O53164	2.06e-13	75.5	542	0.202	0.223	O53164_MYCTU Probable macrolide-transport ATP-binding protein ABC transporter OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1473 PE=1 SV=1
18	Q08972	2.74e-13	75.5	1196	0.144	0.072	NEW1_YEAST [NU+] prion formation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NEW1 PE=1 SV=1
19	O59672	4.78e-13	74.7	736	0.217	0.177	YB89_SCHPO Uncharacterized ABC transporter ATP-binding protein C29A3.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC29A3.09c PE=3 SV=1
20	P10907	2.47e-12	70.9	356	0.090	0.152	UGPC_ECOLI sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli (strain K12) OX=83333 GN=ugpC PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	0.065	25.1	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	3.2e+02	12.7	AAA domain
3	PF13175 AAA_15	0.15	23.2	AAA ATPase domain
4	PF13191 AAA_16	0.06	25.2	AAA ATPase domain
5	PF13238 AAA_18	73	15.3	AAA domain
6	PF13304 AAA_21	5.6e-07	41.2	AAA domain, putative AbiEii toxin, Type IV TA system
7	PF13401 AAA_22	0.16	23.7	AAA domain
8	PF13476 AAA_23	1.4e+02	14.4	AAA domain
9	PF13479 AAA_24	12	17.1	AAA domain
10	PF13521 AAA_28	33	16.2	AAA domain
11	PF13555 AAA_29	0.51	21.5	P-loop containing region of AAA domain
12	PF13604 AAA_30	2.5	19.3	AAA domain
13	PF13671 AAA_33	5.8	18.5	AAA domain
14	PF07728 AAA_5	2.6e+02	13.0	AAA domain (dynein-related subfamily)
15	PF12775 AAA_7	5.3e+02	11.5	P-loop containing dynein motor region
16	PF00005 ABC_tran	2.6e-34	130.1	ABC transporter
17	PF16575 CLP1_P	6.2e+02	11.6	mRNA cleavage and polyadenylation factor CLP1 P-loop
18	PF03796 DnaB_C	3.8e+02	11.7	DnaB-like helicase C terminal domain
19	PF19263 DUF5906	4e+02	13.2	Family of unknown function (DUF5906)
20	PF00037 Fer4	0.00038	31.3	4Fe-4S binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008825705.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008832511.1	0.992	Eukaryotic translation termination factor 1
2	1026970.XP_008849626.1	0.983	Eukaryotic translation initiation factor 3 subunit B
3	1026970.XP_008822158.1	0.982	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 17 mRNAs, 3 ESTs, 17 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns
4	1026970.XP_008846918.1	0.975	Proliferation-associated protein 2G4
5	1026970.XP_008847362.1	0.974	Eukaryotic translation initiation factor 3 subunit J
6	1026970.XP_008845452.1	0.972	ATP-binding cassette sub-family F member 2
7	1026970.XP_008850024.1	0.961	G protein nucleolar 3
8	1026970.XP_008839566.1	0.957	Nucleolar GTP-binding protein 1
9	1026970.XP_008850369.1	0.957	Eukaryotic translation initiation factor 2 subunit 1
10	1026970.XP_008820936.1	0.956	Eukaryotic translation initiation factor 2 subunit gamma
11	1026970.XP_008844172.1	0.952	Receptor for activated C kinase 1
12	1026970.XP_008825541.1	0.950	Eukaryotic translation initiation factor 3 subunit A
13	1026970.XP_008846216.1	0.946	Eukaryotic translation initiation factor 3 subunit I
14	1026970.XP_008825020.1	0.944	glutamyl-prolyl-tRNA synthetase
15	1026970.XP_008839636.1	0.941	DEAD-box helicase 18
16	1026970.XP_008839443.1	0.939	ATP binding cassette subfamily F member 1
17	1026970.XP_008853271.1	0.939	Eukaryotic translation initiation factor 2 subunit beta
18	1026970.XP_008823268.1	0.937	Ribosomal protein L12
19	1026970.XP_008826905.1	0.937	60S ribosomal protein L23a
20	1026970.XP_008849727.1	0.935	Eukaryotic translation initiation factor 3 subunit E

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.993	protein binding
GO:0004857	0.956	enzyme inhibitor activity
GO:0097159	0.912	organic cyclic compound binding
GO:1901363	0.901	heterocyclic compound binding
GO:0043167	0.685	ion binding
GO:0060698	0.485	endoribonuclease inhibitor activity
GO:0003824	0.428	catalytic activity
GO:0017076	0.372	purine nucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.969	biological regulation
GO:0050789	0.963	regulation of biological process
GO:0048519	0.944	negative regulation of biological process
GO:0060255	0.936	regulation of macromolecule metabolic process
GO:0050794	0.924	regulation of cellular process
GO:0009987	0.898	cellular process
GO:0051171	0.786	regulation of nitrogen compound metabolic process
GO:0031323	0.786	regulation of cellular metabolic process
GO:0008152	0.713	metabolic process
GO:0071704	0.696	organic substance metabolic process
GO:0044237	0.568	cellular metabolic process
GO:0080090	0.567	regulation of primary metabolic process
GO:0032069	0.538	regulation of nuclease activity
GO:0044238	0.535	primary metabolic process
GO:0043170	0.527	macromolecule metabolic process
GO:0006807	0.520	nitrogen compound metabolic process
GO:0009892	0.405	negative regulation of metabolic process
GO:0010605	0.393	negative regulation of macromolecule metabolic process
GO:0034641	0.378	cellular nitrogen compound metabolic process
GO:0010467	0.344	gene expression
GO:0048523	0.336	negative regulation of cellular process
GO:0044092	0.334	negative regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043227	0.948	membrane-bounded organelle
GO:0043229	0.941	intracellular organelle
GO:0043231	0.925	intracellular membrane-bounded organelle
GO:0032991	0.874	protein-containing complex
GO:0043233	0.774	organelle lumen
GO:0070013	0.744	intracellular organelle lumen
GO:0016020	0.700	membrane
GO:0005634	0.698	nucleus
GO:0031981	0.543	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]