StarFunc result for job id P61224

User Input

>input (184 residues)
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG
TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL
EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS
CQLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B5X2X6	0.933	0.928	8.539E-37	185	0.940	0.935	B5X2X6.pdb.gz	B5X2X6_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
2	AFDB:P08645	0.928	0.928	2.348E-36	184	0.864	0.864	P08645.pdb.gz	RAP1_DROME Ras-related protein Rap1 OS=Drosophila melanogaster OX=7227 GN=Rap1 PE=2 SV=2
3	AFDB:Q18246	0.949	0.929	2.147E-35	188	0.848	0.830	Q18246.pdb.gz	RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans OX=6239 GN=rap-1 PE=3 SV=1
4	AFDB:P18613	0.949	0.939	9.535E-34	186	0.772	0.763	P18613.pdb.gz	RAPA_DICDI Ras-related protein rapA OS=Dictyostelium discoideum OX=44689 GN=rapA PE=1 SV=1
5	PDB:6kykC	0.896	0.974	1.981E-33	169	0.908	0.988	6kykC.pdb.gz	Shank3 Binds to and Stabilizes the Active Form of Rap1 and HRas GTPases via Its NTD-ANK Tandem with Distinct Mechanisms.
6	AFDB:P15064	0.896	0.873	1.335E-29	189	0.587	0.571	P15064.pdb.gz	RASG_DICDI Ras-like protein rasG OS=Dictyostelium discoideum OX=44689 GN=rasG PE=1 SV=1
7	AFDB:P03967	0.903	0.888	5.716E-29	187	0.598	0.588	P03967.pdb.gz	RASD_DICDI Ras-like protein rasD OS=Dictyostelium discoideum OX=44689 GN=rasD PE=1 SV=2
8	AFDB:P32252	0.895	0.837	1.476E-28	197	0.533	0.497	P32252.pdb.gz	RASB_DICDI Ras-like protein rasB OS=Dictyostelium discoideum OX=44689 GN=rasB PE=1 SV=1
9	AFDB:A0A0G2JTW1	0.905	0.910	2.156E-28	183	0.603	0.607	A0A0G2JTW1.pdb.gz	A0A0G2JTW1_RAT Ras-related protein Rap-2 OS=Rattus norvegicus OX=10116 GN=Rap2a PE=3 SV=1
10	AFDB:A0A1D8PS50	0.903	0.672	2.156E-28	248	0.587	0.435	A0A1D8PS50.pdb.gz	A0A1D8PS50_CANAL Ras family GTPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RSR1 PE=4 SV=1
11	AFDB:P62070	0.884	0.799	2.958E-28	204	0.511	0.461	P62070.pdb.gz	RRAS2_HUMAN Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2 PE=1 SV=1
12	PDB:6zizA	0.891	0.964	2.343E-25	170	0.511	0.553	6zizA.pdb.gz	Drugging all RAS isoforms with one pocket.
13	PDB:7sd0B	0.875	0.924	1.887E-24	174	0.473	0.500	7sd0B.pdb.gz	Structural basis for SHOC2 modulation of RAS signalling.
14	PDB:1kaoA	0.860	0.944	3.048E-23	167	0.592	0.653	1kaoA.pdb.gz	Crystal structures of the small G protein Rap2A in complex with its substrate GTP, with GDP and with GTPgammaS.
15	PDB:6zqtA	0.873	0.927	7.664E-22	173	0.440	0.468	6zqtA.pdb.gz	Affinity maturation of the RLIP76 Ral binding domain to inform the design of stapled peptides targeting the Ral GTPases.
16	PDB:2bovA	0.873	0.927	7.464E-21	173	0.462	0.491	2bovA.pdb.gz	Molecular Recognition of an Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme by Rala Gtpase
17	PDB:7kyzA	0.805	0.789	1.024E-20	188	0.543	0.532	7kyzA.pdb.gz
18	PDB:2gf0B	0.818	0.863	1.999E-19	174	0.391	0.414	2gf0B.pdb.gz	The crystal structure of the human DiRas1 GTPase in the inactive GDP bound state
19	PDB:5szjA	0.865	0.909	4.548E-19	175	0.332	0.349	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
20	PDB:8a4cB	0.856	0.924	8.558E-19	170	0.337	0.365	8a4cB.pdb.gz	Rep15 interacts with several Rab GTPases and has a distinct fold for a Rab effector.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61223	3.03e-136	379	184	1.000	1.000	RAP1B_BOVIN Ras-related protein Rap-1b OS=Bos taurus OX=9913 GN=RAP1B PE=2 SV=1
2	P61224	3.03e-136	379	184	1.000	1.000	RAP1B_HUMAN Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B PE=1 SV=1
3	Q99JI6	3.03e-136	379	184	1.000	1.000	RAP1B_MOUSE Ras-related protein Rap-1b OS=Mus musculus OX=10090 GN=Rap1b PE=1 SV=2
4	Q62636	1.49e-135	378	184	0.995	0.995	RAP1B_RAT Ras-related protein Rap-1b OS=Rattus norvegicus OX=10116 GN=Rap1b PE=1 SV=2
5	C0H8F9	9.33e-133	370	184	0.973	0.973	C0H8F9_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
6	Q6TEN1	3.26e-132	369	184	0.973	0.973	RAP1B_DANRE Ras-related protein Rap-1b OS=Danio rerio OX=7955 GN=rap1b PE=2 SV=1
7	B5XGC1	4.13e-128	359	184	0.940	0.940	B5XGC1_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
8	Q6IQP4	4.84e-127	356	185	0.951	0.946	Q6IQP4_DANRE small monomeric GTPase OS=Danio rerio OX=7955 GN=rap1a PE=1 SV=1
9	P62834	1.14e-124	350	184	0.951	0.951	RAP1A_HUMAN Ras-related protein Rap-1A OS=Homo sapiens OX=9606 GN=RAP1A PE=1 SV=1
10	P62835	1.14e-124	350	184	0.951	0.951	RAP1A_MOUSE Ras-related protein Rap-1A OS=Mus musculus OX=10090 GN=Rap1a PE=1 SV=1
11	P62836	1.14e-124	350	184	0.951	0.951	RAP1A_RAT Ras-related protein Rap-1A OS=Rattus norvegicus OX=10116 GN=Rap1a PE=1 SV=1
12	B5XFY1	1.50e-124	350	185	0.957	0.951	B5XFY1_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
13	F1NSA8	5.47e-124	348	184	0.946	0.946	F1NSA8_CHICK small monomeric GTPase OS=Gallus gallus OX=9031 GN=RAP1A PE=1 SV=2
14	B5X794	1.38e-122	345	185	0.946	0.941	B5X794_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
15	B9EMH1	8.52e-122	343	185	0.946	0.941	B9EMH1_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
16	B5X2X6	6.56e-121	341	185	0.940	0.935	B5X2X6_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
17	Q18246	5.76e-112	318	188	0.848	0.830	RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans OX=6239 GN=rap-1 PE=3 SV=1
18	P08645	1.68e-108	309	184	0.815	0.815	RAP1_DROME Ras-related protein Rap1 OS=Drosophila melanogaster OX=7227 GN=Rap1 PE=2 SV=2
19	P18613	2.73e-106	304	186	0.772	0.763	RAPA_DICDI Ras-related protein rapA OS=Dictyostelium discoideum OX=44689 GN=rapA PE=1 SV=1
20	P13856	1.09e-71	219	272	0.549	0.371	RSR1_YEAST Ras-related protein RSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSR1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	8.6e+02	11.6	AAA domain
2	PF00025 Arf	3.8e-05	34.7	ADP-ribosylation factor family
3	PF00503 G-alpha	13	16.4	G-protein alpha subunit
4	PF00009 GTP_EFTU	0.24	22.5	Elongation factor Tu GTP binding domain
5	PF01926 MMR_HSR1	1.8	20.1	50S ribosome-binding GTPase
6	PF00071 Ras	8.1e-54	193.1	Ras family
7	PF08477 Roc	7.4e-17	73.1	Ras of Complex, Roc, domain of DAPkinase
8	PF03193 RsgA_GTPase	7.4	17.9	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 34839.XP_005397532.1

Rank	PPI partner	STRING score	Description
1	34839.XP_005388067.1	0.968	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 12 samples with support for all annotated introns
2	34839.XP_005393259.1	0.953	Rap guanine nucleotide exchange factor 4 isoform X1
3	34839.XP_005384624.1	0.946	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 15 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 11 samples with support for all annotated introns
4	34839.XP_005394777.1	0.943	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
5	34839.XP_005387164.1	0.939	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 1 EST, 10 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 5 samples with support for all annotated introns
6	34839.XP_005376129.1	0.897	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 3 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns
7	34839.XP_005406680.1	0.890	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 14 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 12 samples with support for all annotated introns
8	34839.XP_005408429.1	0.881	Rap guanine nucleotide exchange factor 1 isoform X1
9	34839.XP_005408991.1	0.877	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 11 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments
10	34839.XP_005390686.1	0.875	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
11	34839.XP_005381259.1	0.861	RAS guanyl-releasing protein 1 isoform X1
12	34839.XP_005375714.1	0.853	T-lymphoma invasion and metastasis-inducing protein 1 isoform X1
13	34839.XP_005375451.1	0.852	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 9 samples with support for all annotated introns
14	34839.XP_005410255.1	0.834	Transforming protein RhoA isoform X1
15	34839.XP_005377625.1	0.828	Dedicator of cytokinesis protein 4
16	34839.XP_005380776.1	0.826	arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X1
17	34839.XP_005390907.1	0.826	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 10 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 10 samples with support for all annotated introns
18	34839.XP_005381141.1	0.825	cAMP-dependent protein kinase catalytic subunit alpha isoform X1
19	34839.XP_005385222.1	0.825	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 16 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 9 samples with support for all annotated introns
20	34839.XP_005398208.1	0.823	Integrin beta-1-like isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003924	0.999	GTPase activity
GO:0098772	0.997	molecular function regulator activity
GO:0035639	0.996	purine ribonucleoside triphosphate binding
GO:0032555	0.996	purine ribonucleotide binding
GO:0005525	0.989	GTP binding
GO:0019899	0.854	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0050794	0.983	regulation of cellular process
GO:0050896	0.982	response to stimulus
GO:0051716	0.973	cellular response to stimulus
GO:0032501	0.960	multicellular organismal process
GO:0023052	0.945	signaling
GO:0048518	0.940	positive regulation of biological process
GO:0007154	0.930	cell communication
GO:0032502	0.927	developmental process
GO:1901698	0.913	response to nitrogen compound
GO:0046683	0.910	response to organophosphorus
GO:0048856	0.909	anatomical structure development
GO:0070372	0.901	regulation of ERK1 and ERK2 cascade
GO:0014074	0.898	response to purine-containing compound
GO:1901699	0.895	cellular response to nitrogen compound
GO:0009719	0.891	response to endogenous stimulus
GO:0007264	0.870	small GTPase mediated signal transduction
GO:0071417	0.865	cellular response to organonitrogen compound
GO:0007275	0.833	multicellular organism development
GO:0048522	0.810	positive regulation of cellular process
GO:0048729	0.795	tissue morphogenesis
GO:0007265	0.787	Ras protein signal transduction
GO:0051128	0.785	regulation of cellular component organization
GO:1901701	0.771	cellular response to oxygen-containing compound
GO:0032879	0.763	regulation of localization
GO:0044087	0.757	regulation of cellular component biogenesis
GO:0002009	0.757	morphogenesis of an epithelium
GO:0048731	0.744	system development
GO:0051591	0.742	response to cAMP
GO:0048519	0.741	negative regulation of biological process
GO:0048869	0.725	cellular developmental process
GO:0030154	0.724	cell differentiation
GO:0048523	0.723	negative regulation of cellular process
GO:0071320	0.722	cellular response to cAMP
GO:0051130	0.718	positive regulation of cellular component organization
GO:1901888	0.714	regulation of cell junction assembly
GO:0003158	0.698	endothelium development
GO:0051179	0.685	localization
GO:0065008	0.672	regulation of biological quality
GO:0048468	0.663	cell development
GO:0045446	0.656	endothelial cell differentiation
GO:0001885	0.651	endothelial cell development
GO:0048513	0.637	animal organ development
GO:0051049	0.613	regulation of transport
GO:0051641	0.605	cellular localization
GO:0009887	0.537	animal organ morphogenesis
GO:0060627	0.533	regulation of vesicle-mediated transport
GO:0071840	0.448	cellular component organization or biogenesis
GO:0019222	0.430	regulation of metabolic process
GO:0048584	0.418	positive regulation of response to stimulus
GO:0016043	0.410	cellular component organization
GO:0060255	0.366	regulation of macromolecule metabolic process
GO:0023056	0.350	positive regulation of signaling
GO:0010647	0.349	positive regulation of cell communication
GO:0060029	0.330	convergent extension involved in organogenesis
GO:0080090	0.328	regulation of primary metabolic process
GO:0043410	0.325	positive regulation of MAPK cascade
GO:0051234	0.315	establishment of localization
GO:0051588	0.302	regulation of neurotransmitter transport
GO:0017157	0.300	regulation of exocytosis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005622	0.986	intracellular anatomical structure
GO:0005737	0.969	cytoplasm
GO:0016020	0.963	membrane
GO:0031982	0.957	vesicle
GO:0005576	0.943	extracellular region
GO:0071944	0.921	cell periphery
GO:0005886	0.897	plasma membrane
GO:0030054	0.855	cell junction
GO:0005615	0.849	extracellular space
GO:0043230	0.847	extracellular organelle
GO:1903561	0.841	extracellular vesicle
GO:0070062	0.831	extracellular exosome
GO:0043229	0.804	intracellular organelle
GO:0043231	0.770	intracellular membrane-bounded organelle
GO:0012505	0.737	endomembrane system
GO:0005829	0.724	cytosol
GO:0070161	0.605	anchoring junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.999	GTP + H2O = GDP + H(+) + phosphate

[back to server]