StarFunc result for job id P61225

User Input

>input (183 residues)
MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAG
TEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDL
EGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSAC
VIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JTW1	0.959	0.959	5.877E-38	183	0.907	0.907	A0A0G2JTW1.pdb.gz	A0A0G2JTW1_RAT Ras-related protein Rap-2 OS=Rattus norvegicus OX=10116 GN=Rap2a PE=3 SV=1
2	AFDB:O17599	0.901	0.911	4.711E-30	181	0.672	0.680	O17599.pdb.gz	O17599_CAEEL small monomeric GTPase OS=Caenorhabditis elegans OX=6239 GN=rap-2 PE=1 SV=2
3	AFDB:Q18246	0.902	0.878	1.087E-29	188	0.634	0.617	Q18246.pdb.gz	RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans OX=6239 GN=rap-1 PE=3 SV=1
4	PDB:1kaoA	0.876	0.958	1.298E-29	167	0.847	0.928	1kaoA.pdb.gz	Crystal structures of the small G protein Rap2A in complex with its substrate GTP, with GDP and with GTPgammaS.
5	AFDB:P08645	0.911	0.906	2.068E-29	184	0.612	0.609	P08645.pdb.gz	RAP1_DROME Ras-related protein Rap1 OS=Drosophila melanogaster OX=7227 GN=Rap1 PE=2 SV=2
6	AFDB:O96692	0.899	0.904	7.980E-29	182	0.661	0.665	O96692.pdb.gz	O96692_DROME small monomeric GTPase OS=Drosophila melanogaster OX=7227 GN=Rap2l PE=1 SV=1
7	AFDB:P03967	0.943	0.924	2.094E-28	187	0.503	0.492	P03967.pdb.gz	RASD_DICDI Ras-like protein rasD OS=Dictyostelium discoideum OX=44689 GN=rasD PE=1 SV=2
8	AFDB:P18613	0.905	0.891	2.539E-28	186	0.574	0.565	P18613.pdb.gz	RAPA_DICDI Ras-related protein rapA OS=Dictyostelium discoideum OX=44689 GN=rapA PE=1 SV=1
9	AFDB:B5X2X6	0.905	0.895	6.248E-28	185	0.617	0.611	B5X2X6.pdb.gz	B5X2X6_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
10	AFDB:P15064	0.897	0.869	8.618E-28	189	0.503	0.487	P15064.pdb.gz	RASG_DICDI Ras-like protein rasG OS=Dictyostelium discoideum OX=44689 GN=rasG PE=1 SV=1
11	AFDB:P32252	0.912	0.849	1.639E-27	197	0.525	0.487	P32252.pdb.gz	RASB_DICDI Ras-like protein rasB OS=Dictyostelium discoideum OX=44689 GN=rasB PE=1 SV=1
12	PDB:6kykC	0.881	0.953	2.404E-26	169	0.596	0.645	6kykC.pdb.gz	Shank3 Binds to and Stabilizes the Active Form of Rap1 and HRas GTPases via Its NTD-ANK Tandem with Distinct Mechanisms.
13	PDB:6zizA	0.895	0.963	5.334E-24	170	0.443	0.476	6zizA.pdb.gz	Drugging all RAS isoforms with one pocket.
14	PDB:7sd0B	0.876	0.921	2.195E-23	174	0.421	0.443	7sd0B.pdb.gz	Structural basis for SHOC2 modulation of RAS signalling.
15	PDB:6zqtA	0.879	0.929	1.110E-21	173	0.410	0.434	6zqtA.pdb.gz	Affinity maturation of the RLIP76 Ral binding domain to inform the design of stapled peptides targeting the Ral GTPases.
16	PDB:2bovA	0.873	0.922	2.911E-21	173	0.426	0.451	2bovA.pdb.gz	Molecular Recognition of an Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme by Rala Gtpase
17	PDB:5szjA	0.865	0.903	3.621E-19	175	0.290	0.303	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
18	PDB:2gf0B	0.813	0.853	1.397E-18	174	0.426	0.448	2gf0B.pdb.gz	The crystal structure of the human DiRas1 GTPase in the inactive GDP bound state
19	PDB:2zetA	0.869	0.878	2.493E-18	181	0.273	0.276	2zetA.pdb.gz	Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases.
20	PDB:5szhB	0.856	0.894	5.057E-18	175	0.322	0.337	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61225	4.22e-135	377	183	1.000	1.000	RAP2B_HUMAN Ras-related protein Rap-2b OS=Homo sapiens OX=9606 GN=RAP2B PE=1 SV=1
2	P61226	4.22e-135	377	183	1.000	1.000	RAP2B_MOUSE Ras-related protein Rap-2b OS=Mus musculus OX=10090 GN=Rap2b PE=1 SV=1
3	A0A0G2JTW1	3.00e-113	321	183	0.907	0.907	A0A0G2JTW1_RAT Ras-related protein Rap-2 OS=Rattus norvegicus OX=10116 GN=Rap2a PE=3 SV=1
4	Q80ZJ1	3.00e-113	321	183	0.907	0.907	RAP2A_MOUSE Ras-related protein Rap-2a OS=Mus musculus OX=10090 GN=Rap2a PE=1 SV=2
5	Q7ZX67	9.48e-113	320	183	0.902	0.902	Q7ZX67_XENLA small monomeric GTPase OS=Xenopus laevis OX=8355 GN=rap2a.S PE=1 SV=1
6	Q8BU31	2.41e-108	309	183	0.858	0.858	RAP2C_MOUSE Ras-related protein Rap-2c OS=Mus musculus OX=10090 GN=Rap2c PE=1 SV=1
7	Q9Y3L5	2.41e-108	309	183	0.858	0.858	RAP2C_HUMAN Ras-related protein Rap-2c OS=Homo sapiens OX=9606 GN=RAP2C PE=1 SV=1
8	P10114	8.24e-107	305	183	0.907	0.907	RAP2A_HUMAN Ras-related protein Rap-2a OS=Homo sapiens OX=9606 GN=RAP2A PE=1 SV=1
9	O17599	8.49e-82	242	181	0.689	0.696	O17599_CAEEL small monomeric GTPase OS=Caenorhabditis elegans OX=6239 GN=rap-2 PE=1 SV=2
10	O96692	2.21e-79	236	182	0.678	0.681	O96692_DROME small monomeric GTPase OS=Drosophila melanogaster OX=7227 GN=Rap2l PE=1 SV=1
11	Q62636	6.95e-78	232	184	0.623	0.620	RAP1B_RAT Ras-related protein Rap-1b OS=Rattus norvegicus OX=10116 GN=Rap1b PE=1 SV=2
12	Q18246	7.77e-78	232	188	0.634	0.617	RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans OX=6239 GN=rap-1 PE=3 SV=1
13	Q6TEN1	9.87e-78	231	184	0.623	0.620	RAP1B_DANRE Ras-related protein Rap-1b OS=Danio rerio OX=7955 GN=rap1b PE=2 SV=1
14	P61223	2.17e-77	231	184	0.617	0.614	RAP1B_BOVIN Ras-related protein Rap-1b OS=Bos taurus OX=9913 GN=RAP1B PE=2 SV=1
15	P61224	2.17e-77	231	184	0.617	0.614	RAP1B_HUMAN Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B PE=1 SV=1
16	Q99JI6	2.17e-77	231	184	0.617	0.614	RAP1B_MOUSE Ras-related protein Rap-1b OS=Mus musculus OX=10090 GN=Rap1b PE=1 SV=2
17	Q6IQP4	3.51e-77	230	185	0.607	0.600	Q6IQP4_DANRE small monomeric GTPase OS=Danio rerio OX=7955 GN=rap1a PE=1 SV=1
18	B5XGC1	3.67e-77	230	184	0.617	0.614	B5XGC1_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
19	C0H8F9	3.67e-77	230	184	0.623	0.620	C0H8F9_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
20	P62834	8.07e-77	229	184	0.612	0.609	RAP1A_HUMAN Ras-related protein Rap-1A OS=Homo sapiens OX=9606 GN=RAP1A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13479 AAA_24	5.9e+02	11.6	AAA domain
2	PF00025 Arf	3.2e-06	38.2	ADP-ribosylation factor family
3	PF02421 FeoB_N	45	15.0	Ferrous iron transport protein B
4	PF00009 GTP_EFTU	0.015	26.4	Elongation factor Tu GTP binding domain
5	PF03308 MeaB	1.3e+02	12.9	Methylmalonyl Co-A mutase-associated GTPase MeaB
6	PF01926 MMR_HSR1	0.6	21.6	50S ribosome-binding GTPase
7	PF16897 MMR_HSR1_Xtn	27	16.2	C-terminal region of MMR_HSR1 domain
8	PF00071 Ras	9.4e-53	189.6	Ras family
9	PF08477 Roc	4.9e-16	70.4	Ras of Complex, Roc, domain of DAPkinase
10	PF03193 RsgA_GTPase	0.0061	28.0	RsgA GTPase
11	PF00205 TPP_enzyme_M	6.7e+02	11.4	Thiamine pyrophosphate enzyme, central domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008842847.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008839521.1	0.811	Rap guanine nucleotide exchange factor 3
2	1026970.XP_008825113.1	0.765	RAB28, member RAS oncogene family
3	1026970.XP_008851302.1	0.745	Phospholipase C epsilon 1
4	1026970.XP_008851886.1	0.661	Rho family GTPase 1
5	1026970.XP_008832208.1	0.650	AP-4 complex subunit beta-1 isoform X1
6	1026970.XP_008830612.1	0.649	AP-4 complex subunit mu-1
7	1026970.XP_008854468.1	0.640	Tuberous sclerosis 2
8	1026970.XP_008853493.1	0.636	Rap guanine nucleotide exchange factor 4
9	1026970.XP_008851126.1	0.626	Rho GTPase activating protein 6
10	1026970.XP_008842247.1	0.615	Rap guanine nucleotide exchange factor 1
11	1026970.XP_008838855.1	0.590	Phospholipase C eta 1
12	1026970.XP_008850866.1	0.590	Phospholipase C eta 2
13	1026970.XP_008832895.1	0.584	ralA-binding protein 1 isoform X1
14	1026970.XP_008826649.1	0.580	Rho GDP-dissociation inhibitor 1
15	1026970.XP_008842332.1	0.576	Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
16	1026970.XP_008830031.1	0.575	Adaptor related protein complex 4 epsilon 1 subunit
17	1026970.XP_008833577.1	0.575	Rho family GTPase 2
18	1026970.XP_008842162.1	0.558	Ral guanine nucleotide dissociation stimulator isoform X1
19	1026970.XP_008837022.1	0.555	Adaptor related protein complex 4 sigma 1 subunit
20	1026970.XP_008849340.1	0.555	Neutrophil cytosolic factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0032553	0.999	ribonucleotide binding
GO:0035639	0.998	purine ribonucleoside triphosphate binding
GO:0019001	0.997	guanyl nucleotide binding
GO:0003824	0.987	catalytic activity
GO:0032555	0.985	purine ribonucleotide binding
GO:0032561	0.979	guanyl ribonucleotide binding
GO:0005525	0.972	GTP binding
GO:0003924	0.959	GTPase activity
GO:0019003	0.864	GDP binding
GO:0019904	0.804	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0050896	0.986	response to stimulus
GO:0051716	0.968	cellular response to stimulus
GO:0001932	0.947	regulation of protein phosphorylation
GO:0031952	0.933	regulation of protein autophosphorylation
GO:0023052	0.915	signaling
GO:0007154	0.912	cell communication
GO:0032501	0.901	multicellular organismal process
GO:0040012	0.860	regulation of locomotion
GO:0035556	0.835	intracellular signal transduction
GO:0007264	0.812	small GTPase mediated signal transduction
GO:2000145	0.806	regulation of cell motility
GO:0030334	0.801	regulation of cell migration
GO:0048518	0.797	positive regulation of biological process
GO:0051247	0.789	positive regulation of protein metabolic process
GO:0045859	0.774	regulation of protein kinase activity
GO:0048522	0.756	positive regulation of cellular process
GO:0030336	0.747	negative regulation of cell migration
GO:0045937	0.731	positive regulation of phosphate metabolic process
GO:0050730	0.728	regulation of peptidyl-tyrosine phosphorylation
GO:0007265	0.722	Ras protein signal transduction
GO:0042327	0.699	positive regulation of phosphorylation
GO:0001934	0.693	positive regulation of protein phosphorylation
GO:0061097	0.670	regulation of protein tyrosine kinase activity
GO:0065008	0.627	regulation of biological quality
GO:0006950	0.623	response to stress
GO:0048856	0.565	anatomical structure development
GO:0071840	0.380	cellular component organization or biogenesis
GO:0048583	0.364	regulation of response to stimulus
GO:0016043	0.333	cellular component organization
GO:0010646	0.316	regulation of cell communication
GO:0051179	0.315	localization
GO:0023051	0.309	regulation of signaling
GO:0007275	0.305	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0031982	0.997	vesicle
GO:0012505	0.981	endomembrane system
GO:0005829	0.978	cytosol
GO:0005886	0.977	plasma membrane
GO:0031090	0.957	organelle membrane
GO:0031410	0.920	cytoplasmic vesicle
GO:0012506	0.873	vesicle membrane
GO:0030659	0.851	cytoplasmic vesicle membrane
GO:0030054	0.837	cell junction
GO:0098588	0.824	bounding membrane of organelle
GO:0055037	0.813	recycling endosome
GO:0010008	0.719	endosome membrane
GO:0055038	0.712	recycling endosome membrane
GO:0045202	0.644	synapse
GO:0005576	0.312	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.959	GTP + H2O = GDP + H(+) + phosphate

[back to server]