StarFunc result for job id P61244

User Input

>input (160 residues)
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR
AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN
SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P28574	0.921	0.921	2.163E-23	160	0.994	0.994	P28574.pdb.gz	MAX_MOUSE Protein max OS=Mus musculus OX=10090 GN=Max PE=1 SV=2
2	AFDB:P52161	0.732	0.713	3.069E-17	165	0.825	0.800	P52161.pdb.gz	MAX_DANRE Protein max OS=Danio rerio OX=7955 GN=max PE=2 SV=1
3	AFDB:Q07016	0.496	0.487	8.674E-14	163	0.775	0.761	Q07016.pdb.gz	MAX_XENLA Protein max OS=Xenopus laevis OX=8355 GN=max PE=2 SV=1
4	AFDB:P91664	0.526	0.523	6.610E-8	161	0.419	0.416	P91664.pdb.gz	MAX_DROME Protein max OS=Drosophila melanogaster OX=7227 GN=Max PE=1 SV=1
5	AFDB:Q18711	0.496	0.343	3.898E-6	235	0.375	0.255	Q18711.pdb.gz	MXL3_CAEEL Protein mxl-3 OS=Caenorhabditis elegans OX=6239 GN=mxl-3 PE=1 SV=1
6	AFDB:G5EEH5	0.497	0.634	1.075E-4	124	0.287	0.371	G5EEH5.pdb.gz	MXL1_CAEEL Max-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=mxl-1 PE=1 SV=1
7	AFDB:O08789	0.529	0.149	1.075E-4	591	0.219	0.059	O08789.pdb.gz	MNT_MOUSE Max-binding protein MNT OS=Mus musculus OX=10090 GN=Mnt PE=2 SV=2
8	AFDB:R4GLV5	0.400	0.066	1.322E-4	1116	0.275	0.039	R4GLV5.pdb.gz
9	AFDB:A6XLD8	0.391	0.068	1.417E-4	1105	0.250	0.036	A6XLD8.pdb.gz	A6XLD8_DANRE Sterol regulatory element binding transcription factor 1 OS=Danio rerio OX=7955 GN=SREBF1 PE=2 SV=1
10	AFDB:Q6YYG5	0.469	0.214	1.518E-4	365	0.237	0.104	Q6YYG5.pdb.gz	Q6YYG5_ORYSJ Os02g0548100 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0548100 PE=3 SV=1
11	PDB:3ojaA	0.353	0.148	8.887E-1	482	0.113	0.037	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
12	PDB:3vh5A	0.191	0.289	3.083	100	0.056	0.090	3vh5A.pdb.gz
13	PDB:7emf2	0.154	0.213	3.303	115	0.106	0.148	7emf2.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
14	PDB:1jnwA	0.139	0.107	4.064	214	0.050	0.037	1jnwA.pdb.gz	Active site structure and stereospecificity of Escherichia coli pyridoxine-5'-phosphate oxidase.
15	PDB:7z37DP1	0.175	0.114	5.000	273	0.163	0.095	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
16	PDB:2bskD	0.210	0.330	5.742	90	0.031	0.056	2bskD.pdb.gz
17	PDB:7mp6B	0.114	0.016	5.742	1609	0.062	0.006	7mp6B.pdb.gz
18	PDB:1oqfA	0.111	0.066	6.152	290	0.037	0.021	1oqfA.pdb.gz
19	PDB:6s1mA	0.125	0.031	6.152	1010	0.069	0.011	6s1mA.pdb.gz	Structure of the processive human Pol delta holoenzyme.
20	PDB:7mp5A	0.114	0.016	6.592	1629	0.062	0.006	7mp5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61244	2.28e-115	325	160	1.000	1.000	MAX_HUMAN Protein max OS=Homo sapiens OX=9606 GN=MAX PE=1 SV=1
2	P28574	7.56e-115	323	160	0.994	0.994	MAX_MOUSE Protein max OS=Mus musculus OX=10090 GN=Max PE=1 SV=2
3	P52164	3.04e-114	322	160	0.988	0.988	MAX_RAT Protein max OS=Rattus norvegicus OX=10116 GN=Max PE=1 SV=1
4	P52161	7.33e-84	245	165	0.831	0.806	MAX_DANRE Protein max OS=Danio rerio OX=7955 GN=max PE=2 SV=1
5	Q07016	2.35e-68	206	163	0.775	0.761	MAX_XENLA Protein max OS=Xenopus laevis OX=8355 GN=max PE=2 SV=1
6	P91664	8.59e-35	121	161	0.406	0.404	MAX_DROME Protein max OS=Drosophila melanogaster OX=7227 GN=Max PE=1 SV=1
7	Q18711	3.63e-20	85.5	235	0.244	0.166	MXL3_CAEEL Protein mxl-3 OS=Caenorhabditis elegans OX=6239 GN=mxl-3 PE=1 SV=1
8	G5EEH5	1.03e-12	63.2	124	0.275	0.355	MXL1_CAEEL Max-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=mxl-1 PE=1 SV=1
9	P01108	1.72e-10	60.5	439	0.231	0.084	MYC_MOUSE Myc proto-oncogene protein OS=Mus musculus OX=10090 GN=Myc PE=1 SV=2
10	P09416	3.24e-10	59.7	439	0.231	0.084	MYC_RAT Myc proto-oncogene protein OS=Rattus norvegicus OX=10116 GN=Myc PE=1 SV=2
11	P01109	3.54e-10	59.3	416	0.206	0.079	MYC_CHICK Myc proto-oncogene protein OS=Gallus gallus OX=9031 GN=MYC PE=1 SV=2
12	P04198	4.27e-10	59.3	464	0.206	0.071	MYCN_HUMAN N-myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYCN PE=1 SV=2
13	P03966	4.60e-10	58.9	462	0.206	0.071	MYCN_MOUSE N-myc proto-oncogene protein OS=Mus musculus OX=10090 GN=Mycn PE=2 SV=2
14	A0A1W2PPD9	6.25e-10	58.2	253	0.219	0.138	A0A1W2PPD9_HUMAN MYCN proto-oncogene, bHLH transcription factor OS=Homo sapiens OX=9606 GN=MYCN PE=1 SV=1
15	O08789	1.13e-09	58.2	591	0.244	0.066	MNT_MOUSE Max-binding protein MNT OS=Mus musculus OX=10090 GN=Mnt PE=2 SV=2
16	Q28350	1.28e-09	57.8	439	0.225	0.082	MYC_CANLF Myc proto-oncogene protein OS=Canis lupus familiaris OX=9615 GN=MYC PE=2 SV=2
17	A0A0S2Z4U5	1.60e-09	57.4	310	0.231	0.119	A0A0S2Z4U5_HUMAN Upstream transcription factor 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=USF1 PE=2 SV=1
18	P22415	1.60e-09	57.4	310	0.231	0.119	USF1_HUMAN Upstream stimulatory factor 1 OS=Homo sapiens OX=9606 GN=USF1 PE=1 SV=1
19	P06646	1.84e-09	57.4	414	0.206	0.080	MYC_ONCMY Transcriptional regulator Myc (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=myc PE=3 SV=1
20	Q2L4Q4	2.06e-09	57.0	407	0.206	0.081	Q2L4Q4_ONCMY Transcriptional regulator OS=Oncorhynchus mykiss OX=8022 GN=myc PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07716 bZIP_2	44	15.6	Basic region leucine zipper
2	PF15960 DUF4763	8.6e+02	10.6	Domain of unknown function (DUF4763)
3	PF18077 DUF5595	2.7e+02	13.0	Domain of unknown function (DUF5595)
4	PF18982 DUF5716	9.9	16.2	Family of unknown function (DUF5716)
5	PF00038 Filament	22	16.1	Intermediate filament protein
6	PF02183 HALZ	4.5e+02	12.5	Homeobox associated leucine zipper
7	PF00010 HLH	6.8e-14	62.9	Helix-loop-helix DNA-binding domain
8	PF09744 Jnk-SapK_ap_N	1e+02	14.7	JNK_SAPK-associated protein-1
9	PF15341 SLX9	2.3e+02	13.6	Ribosome biogenesis protein SLX9
10	PF04102 SlyX	90	15.1	SlyX
11	PF06005 ZapB	4.1e+02	12.9	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008581160.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008567614.1	0.998	Myc proto-oncogene protein
2	482537.XP_008574393.1	0.996	Max dimerization protein 1
3	482537.XP_008568161.1	0.977	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 18 Proteins, and 90% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
4	482537.XP_008586589.1	0.977	E3 ubiquitin-protein ligase RING2
5	482537.XP_008585751.1	0.970	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 8 Proteins, and 94% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
6	482537.XP_008580551.1	0.966	ruvB-like 1
7	482537.XP_008568993.1	0.964	N-myc proto-oncogene protein
8	482537.XP_008567539.1	0.956	ruvB-like 2
9	482537.XP_008572284.1	0.955	chromodomain-helicase-DNA-binding protein 8 isoform X1
10	482537.XP_008572389.1	0.937	WD repeat-containing protein 5 isoform X1
11	482537.XP_008587006.1	0.934	Transformation/transcription domain-associated protein isoform X1
12	482537.XP_008589642.1	0.929	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
13	482537.XP_008571183.1	0.927	Transcription factor E2F6 isoform X1
14	482537.XP_008576398.1	0.925	INO80 complex subunit C-like
15	482537.XP_008588309.1	0.925	Transcription initiation factor TFIID subunit 6 isoform X1
16	482537.XP_008592514.1	0.916	Histone acetyltransferase KAT8 isoform X1
17	482537.XP_008576623.1	0.912	Host cell factor 1 isoform X1
18	482537.XP_008590181.1	0.908	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 12 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
19	482537.XP_008567686.1	0.906	Transcription initiation factor TFIID subunit 7
20	482537.XP_008562348.1	0.903	Adenylate kinase isoenzyme 6-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140110	0.964	transcription regulator activity
GO:0003700	0.928	DNA-binding transcription factor activity
GO:0140297	0.641	DNA-binding transcription factor binding
GO:0000981	0.511	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0042802	0.509	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.995	regulation of DNA-templated transcription
GO:0048518	0.940	positive regulation of biological process
GO:0048522	0.931	positive regulation of cellular process
GO:0009893	0.902	positive regulation of metabolic process
GO:0010604	0.853	positive regulation of macromolecule metabolic process
GO:0006357	0.816	regulation of transcription by RNA polymerase II
GO:0009987	0.809	cellular process
GO:0031325	0.782	positive regulation of cellular metabolic process
GO:0051173	0.778	positive regulation of nitrogen compound metabolic process
GO:0048519	0.691	negative regulation of biological process
GO:0045935	0.650	positive regulation of nucleobase-containing compound metabolic process
GO:0048523	0.626	negative regulation of cellular process
GO:0009891	0.541	positive regulation of biosynthetic process
GO:0031328	0.533	positive regulation of cellular biosynthetic process
GO:0045893	0.515	positive regulation of DNA-templated transcription
GO:0009892	0.428	negative regulation of metabolic process
GO:0045944	0.415	positive regulation of transcription by RNA polymerase II
GO:0010605	0.407	negative regulation of macromolecule metabolic process
GO:0031324	0.386	negative regulation of cellular metabolic process
GO:0051172	0.382	negative regulation of nitrogen compound metabolic process
GO:0045934	0.314	negative regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005634	1.000	nucleus
GO:0005654	0.993	nucleoplasm
GO:0043232	0.949	intracellular non-membrane-bounded organelle
GO:0140513	0.868	nuclear protein-containing complex
GO:0005667	0.819	transcription regulator complex
GO:0005737	0.745	cytoplasm
GO:0090575	0.677	RNA polymerase II transcription regulator complex
GO:1902494	0.404	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]