StarFunc result for job id P61289

User Input

>input (254 residues)
MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHS
DMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIE
KVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQIS
RYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIE
KIKRPRSSNAETLY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R203	0.882	0.846	1.983E-31	265	0.953	0.913	A0A024R203.pdb.gz
2	AFDB:K9J957	0.742	0.811	1.387E-25	231	0.906	0.996	K9J957.pdb.gz	K9J957_HUMAN Proteasome activator subunit 3 OS=Homo sapiens OX=9606 GN=PSME3 PE=1 SV=1
3	PDB:7yqcA	0.768	0.982	6.177E-24	198	0.772	0.990	7yqcA.pdb.gz
4	AFDB:Q9V3P3	0.867	0.898	2.341E-21	245	0.461	0.478	Q9V3P3.pdb.gz	Q9V3P3_DROME LD45860p OS=Drosophila melanogaster OX=7227 GN=REG PE=1 SV=1
5	AFDB:P97371	0.828	0.844	1.392E-17	249	0.402	0.410	P97371.pdb.gz	PSME1_MOUSE Proteasome activator complex subunit 1 OS=Mus musculus OX=10090 GN=Psme1 PE=1 SV=2
6	PDB:5mx5L	0.778	0.919	1.978E-16	214	0.386	0.458	5mx5L.pdb.gz
7	AFDB:P97372	0.816	0.866	4.731E-16	239	0.335	0.356	P97372.pdb.gz	PSME2_MOUSE Proteasome activator complex subunit 2 OS=Mus musculus OX=10090 GN=Psme2 PE=1 SV=4
8	PDB:7naod	0.808	0.943	2.255E-15	217	0.323	0.378	7naod.pdb.gz
9	AFDB:Q967U1	0.698	0.783	7.596E-12	225	0.303	0.342	Q967U1.pdb.gz	PSME_DICDI Proteasome activator 28 OS=Dictyostelium discoideum OX=44689 GN=psmE3 PE=1 SV=1
10	AFDB:Q38BM8	0.643	0.702	2.203E-4	231	0.134	0.147	Q38BM8.pdb.gz	Q38BM8_TRYB2 Proteasome activator protein PA26 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3660 PE=1 SV=1
11	PDB:3ipmO	0.571	0.651	4.086E-4	219	0.126	0.146	3ipmO.pdb.gz
12	AFDB:A0A0R4IKX7	0.217	0.177	6.026E-2	326	0.130	0.101	A0A0R4IKX7.pdb.gz
13	AFDB:E7ESA6	0.227	0.069	1.548E-1	1096	0.150	0.035	E7ESA6.pdb.gz	E7ESA6_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
14	AFDB:O65359	0.168	0.142	2.086E-1	322	0.114	0.090	O65359.pdb.gz	SYP41_ARATH Tlg2p-like protein a OS=Arabidopsis thaliana OX=3702 GN=SYP41 PE=1 SV=1
15	PDB:4kxrB	0.186	0.255	6.681E-1	174	0.083	0.121	4kxrB.pdb.gz
16	PDB:4q25A	0.181	0.209	9.000E-1	211	0.091	0.109	4q25A.pdb.gz
17	PDB:7q83D	0.181	0.261	1.154	156	0.067	0.109	7q83D.pdb.gz
18	PDB:6ylgb	0.230	0.115	1.212	613	0.079	0.033	6ylgb.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
19	PDB:3szrA	0.212	0.110	1.274	559	0.087	0.039	3szrA.pdb.gz
20	PDB:6elzb	0.154	0.106	1.274	421	0.067	0.040	6elzb.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61289	0.0	518	254	1.000	1.000	PSME3_HUMAN Proteasome activator complex subunit 3 OS=Homo sapiens OX=9606 GN=PSME3 PE=1 SV=1
2	V9HWJ8	0.0	518	254	1.000	1.000	V9HWJ8_HUMAN Epididymis secretory protein Li 283 OS=Homo sapiens OX=9606 GN=HEL-S-283 PE=2 SV=1
3	K9J957	2.24e-164	456	231	0.909	1.000	K9J957_HUMAN Proteasome activator subunit 3 OS=Homo sapiens OX=9606 GN=PSME3 PE=1 SV=1
4	K7ENH2	5.58e-125	354	179	0.705	1.000	K7ENH2_HUMAN Proteasome activator subunit 3 (Fragment) OS=Homo sapiens OX=9606 GN=PSME3 PE=1 SV=1
5	Q9V3P3	1.34e-85	256	245	0.465	0.482	Q9V3P3_DROME LD45860p OS=Drosophila melanogaster OX=7227 GN=REG PE=1 SV=1
6	Q06323	6.87e-64	201	249	0.398	0.406	PSME1_HUMAN Proteasome activator complex subunit 1 OS=Homo sapiens OX=9606 GN=PSME1 PE=1 SV=1
7	Q2KJE7	3.17e-63	200	249	0.406	0.414	Q2KJE7_BOVIN Proteasome (Prosome, macropain) activator subunit 1 (PA28 alpha) OS=Bos taurus OX=9913 GN=PSME1 PE=2 SV=1
8	P97371	8.07e-63	199	249	0.394	0.402	PSME1_MOUSE Proteasome activator complex subunit 1 OS=Mus musculus OX=10090 GN=Psme1 PE=1 SV=2
9	Q9UL46	1.04e-40	142	239	0.327	0.347	PSME2_HUMAN Proteasome activator complex subunit 2 OS=Homo sapiens OX=9606 GN=PSME2 PE=1 SV=4
10	P97372	2.39e-40	141	239	0.331	0.351	PSME2_MOUSE Proteasome activator complex subunit 2 OS=Mus musculus OX=10090 GN=Psme2 PE=1 SV=4
11	Q967U1	3.33e-35	127	225	0.264	0.298	PSME_DICDI Proteasome activator 28 OS=Dictyostelium discoideum OX=44689 GN=psmE3 PE=1 SV=1
12	Q07845	0.047	37.4	632	0.138	0.055	GRC3_YEAST Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GRC3 PE=1 SV=1
13	I6L9F6	1.5	32.3	284	0.091	0.081	I6L9F6_HUMAN NEFL protein OS=Homo sapiens OX=9606 GN=NEFL PE=1 SV=1
14	Q8SQD4	2.1	30.4	113	0.083	0.186	Q8SQD4_MACMU EP2C protein OS=Macaca mulatta OX=9544 GN=EP2 PE=2 SV=1
15	Q8SQD1	3.1	30.0	118	0.083	0.178	Q8SQD1_MACMU EP2K protein OS=Macaca mulatta OX=9544 GN=EP2 PE=2 SV=1
16	P07196	4.6	31.2	543	0.102	0.048	NFL_HUMAN Neurofilament light polypeptide OS=Homo sapiens OX=9606 GN=NEFL PE=1 SV=3
17	P02547	5.1	30.8	549	0.102	0.047	NFL_PIG Neurofilament light polypeptide OS=Sus scrofa OX=9823 GN=NEFL PE=1 SV=3
18	Q06401	6.6	30.4	573	0.083	0.037	3O1D_COMTE 3-oxosteroid 1-dehydrogenase OS=Comamonas testosteroni OX=285 PE=1 SV=1
19	P51567	7.3	30.4	427	0.098	0.059	AFC2_ARATH Serine/threonine-protein kinase AFC2 OS=Arabidopsis thaliana OX=3702 GN=AFC2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02251 PA28_alpha	3.4e-22	89.6	Proteasome activator pa28 alpha subunit
2	PF02252 PA28_beta	2.9e-62	220.2	Proteasome activator pa28 beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008833566.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008830337.1	0.971	Proteasome subunit beta type-2
2	1026970.XP_008821634.1	0.951	Proteasome subunit alpha type-4
3	1026970.XP_008838052.1	0.947	Proteasome activator subunit 2
4	1026970.XP_008838053.1	0.946	Proteasome activator complex subunit 1
5	1026970.XP_008837735.1	0.931	Proteasome subunit alpha type-3
6	1026970.XP_008837793.1	0.917	Proteasome 26S subunit, ATPase 6
7	1026970.XP_008819768.1	0.911	Tumor necrosis factor
8	1026970.XP_008848617.1	0.909	Proteasome subunit alpha 5
9	1026970.XP_008837277.1	0.880	Proteasome subunit beta type-10
10	1026970.XP_008851742.1	0.875	Proteasome subunit alpha type-1
11	1026970.XP_008843496.1	0.866	Proteasome subunit beta 3
12	1026970.XP_008848975.1	0.864	Proteasome subunit beta type-9
13	1026970.XP_008822797.1	0.863	Proteasome subunit beta type-7
14	1026970.XP_008852132.1	0.861	26S proteasome non-ATPase regulatory subunit 8
15	1026970.XP_008841625.1	0.856	Proteasome subunit beta 1
16	1026970.XP_008832566.1	0.855	Heat shock protein family A (Hsp70) member 14
17	1026970.XP_008841452.1	0.855	Proteasome subunit alpha 7
18	1026970.XP_008845858.1	0.854	Proteasome subunit alpha 8
19	1026970.XP_008854123.1	0.854	Proteasome subunit beta type-6 isoform X1
20	1026970.XP_008831132.1	0.851	Proteasome subunit alpha type-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061133	1.000	endopeptidase activator activity
GO:0002039	0.992	p53 binding
GO:0042802	0.987	identical protein binding
GO:0097371	0.321	MDM2/MDM4 family protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0023051	0.976	regulation of signaling
GO:0010646	0.976	regulation of cell communication
GO:0048583	0.975	regulation of response to stimulus
GO:0042176	0.958	regulation of protein catabolic process
GO:0010941	0.957	regulation of cell death
GO:0042981	0.954	regulation of apoptotic process
GO:0048523	0.938	negative regulation of cellular process
GO:1903050	0.936	regulation of proteolysis involved in protein catabolic process
GO:0048585	0.935	negative regulation of response to stimulus
GO:0023057	0.922	negative regulation of signaling
GO:0010648	0.922	negative regulation of cell communication
GO:0009966	0.922	regulation of signal transduction
GO:2001233	0.910	regulation of apoptotic signaling pathway
GO:0060548	0.905	negative regulation of cell death
GO:0009968	0.874	negative regulation of signal transduction
GO:2001236	0.851	regulation of extrinsic apoptotic signaling pathway
GO:0043066	0.824	negative regulation of apoptotic process
GO:0061136	0.812	regulation of proteasomal protein catabolic process
GO:0009987	0.768	cellular process
GO:2001234	0.677	negative regulation of apoptotic signaling pathway
GO:2001237	0.639	negative regulation of extrinsic apoptotic signaling pathway
GO:0008152	0.415	metabolic process
GO:0071704	0.403	organic substance metabolic process
GO:0044238	0.312	primary metabolic process
GO:0006807	0.310	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0032991	0.810	protein-containing complex
GO:1902494	0.596	catalytic complex
GO:0140535	0.436	intracellular protein-containing complex
GO:1905368	0.419	peptidase complex
GO:0000502	0.399	proteasome complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]