StarFunc result for job id P61296

User Input

>input (217 residues)
MSLVGGFPHHPVVHHEGYPFAAAAAAAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSM
ALSYSPEYASGAAGLDHSHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFA
ELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEK
RKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61295	0.793	0.793	1.171E-31	217	1.000	1.000	P61295.pdb.gz	HAND2_RAT Heart- and neural crest derivatives-expressed protein 2 OS=Rattus norvegicus OX=10116 GN=Hand2 PE=2 SV=1
2	AFDB:Q90690	0.603	0.605	6.367E-27	216	0.871	0.875	Q90690.pdb.gz	HAND2_CHICK Heart- and neural crest derivatives-expressed protein 2 OS=Gallus gallus OX=9031 GN=HAND2 PE=2 SV=1
3	AFDB:P57102	0.616	0.639	5.952E-25	208	0.834	0.870	P57102.pdb.gz	HAND2_DANRE Heart- and neural crest derivatives-expressed protein 2 OS=Danio rerio OX=7955 GN=hand2 PE=2 SV=1
4	AFDB:P97832	0.449	0.451	2.158E-14	216	0.521	0.523	P97832.pdb.gz	HAND1_RAT Heart- and neural crest derivatives-expressed protein 1 OS=Rattus norvegicus OX=10116 GN=Hand1 PE=2 SV=2
5	AFDB:Q32PV5	0.297	0.361	2.312E-6	176	0.235	0.290	Q32PV5.pdb.gz	TCF21_DANRE Transcription factor 21 OS=Danio rerio OX=7955 GN=tcf21 PE=2 SV=1
6	AFDB:O35437	0.293	0.350	1.175E-5	179	0.221	0.268	O35437.pdb.gz	TCF21_MOUSE Transcription factor 21 OS=Mus musculus OX=10090 GN=Tcf21 PE=2 SV=1
7	AFDB:O88940	0.285	0.306	1.175E-5	201	0.240	0.259	O88940.pdb.gz	MUSC_MOUSE Musculin OS=Mus musculus OX=10090 GN=Msc PE=1 SV=1
8	AFDB:P26687	0.279	0.293	3.032E-5	206	0.230	0.243	P26687.pdb.gz	TWST1_MOUSE Twist-related protein 1 OS=Mus musculus OX=10090 GN=Twist1 PE=1 SV=1
9	AFDB:Q0IGT4	0.302	0.343	3.032E-5	189	0.203	0.233	Q0IGT4.pdb.gz	Q0IGT4_DROME Cousin of atonal OS=Drosophila melanogaster OX=7227 GN=cato PE=2 SV=1
10	AFDB:E7F361	0.298	0.322	3.244E-5	200	0.267	0.290	E7F361.pdb.gz
11	PDB:7ungi	0.131	0.117	1.376	250	0.111	0.096	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
12	PDB:6ke6RQ	0.102	0.095	1.931	226	0.120	0.115	6ke6RQ.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
13	PDB:4v6wCh	0.119	0.193	3.319	123	0.092	0.163	4v6wCh.pdb.gz	Structures of the human and Drosophila 80S ribosome.
14	PDB:2bskD	0.154	0.285	3.800	90	0.065	0.156	2bskD.pdb.gz
15	PDB:7qsdd	0.116	0.199	5.332	120	0.074	0.133	7qsdd.pdb.gz	Structural basis of mammalian respiratory complex I inhibition by medicinal biguanides.
16	PDB:6so5C	0.146	0.212	6.533	144	0.028	0.042	6so5C.pdb.gz	Structural Basis of Tail-Anchored Membrane Protein Biogenesis by the GET Insertase Complex.
17	PDB:7tbhA	0.124	0.112	6.533	243	0.074	0.066	7tbhA.pdb.gz	Cryo-EM, Protein Engineering, and Simulation Enable the Development of Peptide Therapeutics against Acute Myeloid Leukemia.
18	PDB:5a9q3	0.132	0.059	6.991	528	0.088	0.036	5a9q3.pdb.gz
19	PDB:6jcxF	0.102	0.113	6.991	186	0.097	0.113	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
20	PDB:6lo8E	0.157	0.359	6.991	80	0.028	0.075	6lo8E.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61295	1.20e-162	449	217	1.000	1.000	HAND2_RAT Heart- and neural crest derivatives-expressed protein 2 OS=Rattus norvegicus OX=10116 GN=Hand2 PE=2 SV=1
2	P61296	1.20e-162	449	217	1.000	1.000	HAND2_HUMAN Heart- and neural crest derivatives-expressed protein 2 OS=Homo sapiens OX=9606 GN=HAND2 PE=1 SV=1
3	Q61039	1.20e-162	449	217	1.000	1.000	HAND2_MOUSE Heart- and neural crest derivatives-expressed protein 2 OS=Mus musculus OX=10090 GN=Hand2 PE=1 SV=3
4	P57102	3.06e-118	336	208	0.816	0.851	HAND2_DANRE Heart- and neural crest derivatives-expressed protein 2 OS=Danio rerio OX=7955 GN=hand2 PE=2 SV=1
5	Q90690	2.00e-117	335	216	0.871	0.875	HAND2_CHICK Heart- and neural crest derivatives-expressed protein 2 OS=Gallus gallus OX=9031 GN=HAND2 PE=2 SV=1
6	P97832	1.38e-58	185	216	0.516	0.519	HAND1_RAT Heart- and neural crest derivatives-expressed protein 1 OS=Rattus norvegicus OX=10116 GN=Hand1 PE=2 SV=2
7	Q64279	4.99e-58	184	216	0.512	0.514	HAND1_MOUSE Heart- and neural crest derivatives-expressed protein 1 OS=Mus musculus OX=10090 GN=Hand1 PE=1 SV=1
8	O96004	5.05e-58	184	215	0.502	0.507	HAND1_HUMAN Heart- and neural crest derivatives-expressed protein 1 OS=Homo sapiens OX=9606 GN=HAND1 PE=1 SV=1
9	Q9VL05	1.06e-35	125	174	0.350	0.437	Q9VL05_DROME FI14601p OS=Drosophila melanogaster OX=7227 GN=Hand PE=2 SV=3
10	Q60756	8.15e-16	74.7	195	0.198	0.221	TCF15_MOUSE Transcription factor 15 OS=Mus musculus OX=10090 GN=Tcf15 PE=1 SV=2
11	P59101	1.60e-14	70.9	187	0.166	0.193	SCX_CHICK Basic helix-loop-helix transcription factor scleraxis OS=Gallus gallus OX=9031 GN=SCX PE=2 SV=1
12	B5DFF0	2.71e-14	71.2	228	0.161	0.154	B5DFF0_RAT Scx protein OS=Rattus norvegicus OX=10116 GN=Scx PE=2 SV=1
13	Q7RTU7	3.12e-14	70.5	201	0.161	0.174	SCX_HUMAN Basic helix-loop-helix transcription factor scleraxis OS=Homo sapiens OX=9606 GN=SCX PE=1 SV=1
14	Q64124	3.63e-14	70.5	207	0.161	0.169	SCX_MOUSE Basic helix-loop-helix transcription factor scleraxis OS=Mus musculus OX=10090 GN=Scx PE=1 SV=1
15	Q12870	4.63e-14	70.1	199	0.166	0.181	TCF15_HUMAN Transcription factor 15 OS=Homo sapiens OX=9606 GN=TCF15 PE=2 SV=3
16	P97831	1.26e-13	68.2	160	0.152	0.206	TWST2_RAT Twist-related protein 2 OS=Rattus norvegicus OX=10116 GN=Twist2 PE=2 SV=2
17	Q8WVJ9	1.26e-13	68.2	160	0.152	0.206	TWST2_HUMAN Twist-related protein 2 OS=Homo sapiens OX=9606 GN=TWIST2 PE=1 SV=1
18	Q9D030	1.33e-13	67.8	160	0.152	0.206	TWST2_MOUSE Twist-related protein 2 OS=Mus musculus OX=10090 GN=Twist2 PE=1 SV=1
19	P13903	1.38e-13	68.2	166	0.147	0.193	TWIST_XENLA Twist-related protein OS=Xenopus laevis OX=8355 GN=twist1 PE=2 SV=1
20	Q9PTE3	1.54e-13	68.2	171	0.152	0.193	Q9PTE3_DANRE Transcription factor twist1 OS=Danio rerio OX=7955 GN=Twist1b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	3.2e-15	67.2	Helix-loop-helix DNA-binding domain
2	PF18558 HTH_51	4.2e+02	12.2	Helix-turn-helix domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008845360.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008848997.1	0.902	Homeobox protein Nkx-2.5
2	1026970.XP_008837647.1	0.863	Myocyte-specific enhancer factor 2C isoform X1
3	1026970.XP_008840564.1	0.781	Heart and neural crest derivatives expressed 1
4	1026970.XP_008826380.1	0.762	Transcription factor GATA-4
5	1026970.XP_008835361.1	0.761	Transcription factor E2-alpha isoform X1
6	1026970.XP_008830164.1	0.760	Homeobox protein Nkx-2.3
7	1026970.XP_008825112.1	0.748	Homeobox protein Nkx-3.2
8	1026970.XP_008845689.1	0.748	T-box 5
9	1026970.XP_008847739.1	0.711	Myocyte-specific enhancer factor 2A isoform X1
10	1026970.XP_008848910.1	0.703	Nuclear factor of activated T-cells 1
11	1026970.XP_008825194.1	0.690	GATA binding protein 6
12	1026970.XP_008841464.1	0.689	Transcription factor GATA-5
13	1026970.XP_008846993.1	0.658	T-box transcription factor TBX20
14	1026970.XP_008847572.1	0.647	Interleukin-4
15	1026970.XP_008851779.1	0.647	Myocyte-specific enhancer factor 2D isoform X1
16	1026970.XP_008823604.1	0.644	CD4 molecule
17	1026970.XP_008845202.1	0.644	Interferon gamma
18	1026970.XP_008847570.1	0.644	Interleukin-5
19	1026970.XP_008847571.1	0.644	Interleukin-13
20	1026970.XP_008823341.1	0.643	GATA binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140297	1.000	DNA-binding transcription factor binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001221	0.993	transcription coregulator binding
GO:0070888	0.993	E-box binding
GO:0061629	0.991	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001223	0.977	transcription coactivator binding
GO:0046983	0.689	protein dimerization activity
GO:0000217	0.686	DNA secondary structure binding
GO:0042802	0.640	identical protein binding
GO:0042803	0.617	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007275	0.995	multicellular organism development
GO:0009987	0.988	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0048513	0.976	animal organ development
GO:0048731	0.969	system development
GO:0060255	0.967	regulation of macromolecule metabolic process
GO:0009653	0.963	anatomical structure morphogenesis
GO:0010468	0.961	regulation of gene expression
GO:0007507	0.957	heart development
GO:0051171	0.944	regulation of nitrogen compound metabolic process
GO:0031323	0.944	regulation of cellular metabolic process
GO:0080090	0.942	regulation of primary metabolic process
GO:0048518	0.941	positive regulation of biological process
GO:0048522	0.924	positive regulation of cellular process
GO:0050896	0.885	response to stimulus
GO:0010556	0.866	regulation of macromolecule biosynthetic process
GO:0031326	0.865	regulation of cellular biosynthetic process
GO:0019219	0.865	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.858	regulation of DNA-templated transcription
GO:0009893	0.787	positive regulation of metabolic process
GO:0010604	0.776	positive regulation of macromolecule metabolic process
GO:0048519	0.771	negative regulation of biological process
GO:0051239	0.735	regulation of multicellular organismal process
GO:0031325	0.732	positive regulation of cellular metabolic process
GO:0051173	0.719	positive regulation of nitrogen compound metabolic process
GO:0048523	0.703	negative regulation of cellular process
GO:0009888	0.697	tissue development
GO:0009887	0.694	animal organ morphogenesis
GO:0030154	0.668	cell differentiation
GO:0006357	0.652	regulation of transcription by RNA polymerase II
GO:0009891	0.516	positive regulation of biosynthetic process
GO:0051716	0.505	cellular response to stimulus
GO:0031328	0.505	positive regulation of cellular biosynthetic process
GO:0045935	0.501	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.499	positive regulation of macromolecule biosynthetic process
GO:0045893	0.493	positive regulation of DNA-templated transcription
GO:0051240	0.476	positive regulation of multicellular organismal process
GO:0048583	0.475	regulation of response to stimulus
GO:0050793	0.466	regulation of developmental process
GO:0003007	0.450	heart morphogenesis
GO:0045944	0.449	positive regulation of transcription by RNA polymerase II
GO:0042221	0.445	response to chemical
GO:0045595	0.440	regulation of cell differentiation
GO:0009790	0.435	embryo development
GO:0009892	0.420	negative regulation of metabolic process
GO:0008152	0.403	metabolic process
GO:0010646	0.400	regulation of cell communication
GO:0010605	0.395	negative regulation of macromolecule metabolic process
GO:0014706	0.391	striated muscle tissue development
GO:0048468	0.387	cell development
GO:0071704	0.372	organic substance metabolic process
GO:0048598	0.369	embryonic morphogenesis
GO:0060485	0.363	mesenchyme development
GO:0023051	0.321	regulation of signaling
GO:0009966	0.305	regulation of signal transduction
GO:0042127	0.302	regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.989	protein-containing complex
GO:0070013	0.971	intracellular organelle lumen
GO:0031981	0.947	nuclear lumen
GO:0005654	0.902	nucleoplasm
GO:0043228	0.514	non-membrane-bounded organelle
GO:0043232	0.470	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]