StarFunc result for job id P61326

User Input

>input (146 residues)
MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEEL
KRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLR
VFYYLVQDLKCLVFSLIGLHFKIKPI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1M0X6	0.998	0.984	1.931E-28	148	0.986	0.973	F1M0X6.pdb.gz	F1M0X6_RAT Mago homolog B, exon junction complex subunit OS=Rattus norvegicus OX=10116 GN=Magohb PE=3 SV=2
2	AFDB:P49028	0.991	0.984	5.426E-27	147	0.904	0.898	P49028.pdb.gz	MGN_DROME Protein mago nashi OS=Drosophila melanogaster OX=7227 GN=mago PE=1 SV=1
3	AFDB:O23676	0.983	0.957	2.737E-25	150	0.767	0.747	O23676.pdb.gz	MGN_ARATH Protein mago nashi homolog OS=Arabidopsis thaliana OX=3702 GN=MAGO PE=1 SV=1
4	AFDB:P49030	0.957	0.874	2.737E-25	160	0.815	0.744	P49030.pdb.gz	MGN2_ORYSJ Protein mago nashi homolog 2 OS=Oryza sativa subsp. japonica OX=39947 GN=MAGO2 PE=1 SV=2
5	AFDB:P49029	0.978	0.940	5.210E-25	152	0.795	0.763	P49029.pdb.gz	MGN_CAEEL Protein mago nashi homolog OS=Caenorhabditis elegans OX=6239 GN=mag-1 PE=1 SV=2
6	PDB:5xjcv	0.941	0.954	5.737E-25	144	0.986	1.000	5xjcv.pdb.gz	An Atomic Structure of the Human Spliceosome
7	PDB:2x1gB	0.920	0.959	5.196E-23	140	0.863	0.900	2x1gB.pdb.gz
8	AFDB:O43037	0.944	0.938	5.093E-21	147	0.616	0.612	O43037.pdb.gz	MGN_SCHPO Protein mago nashi homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnh1 PE=3 SV=1
9	AFDB:Q586G7	0.923	0.916	5.186E-19	147	0.541	0.537	Q586G7.pdb.gz	Q586G7_TRYB2 Mago nashi-like protein,putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.30P15.540 PE=3 SV=1
10	AFDB:Q9VU86	0.247	0.038	1.307E-3	1873	0.110	0.009	Q9VU86.pdb.gz	Q9VU86_DROME LD34837p OS=Drosophila melanogaster OX=7227 GN=Spt20 PE=1 SV=3
11	PDB:5dg2B	0.150	0.157	9.365E-3	131	0.096	0.107	5dg2B.pdb.gz	Human galectin-2 interacts with carbohydrates and peptides non-classically: new insight from X-ray crystallography and hemagglutination.
12	AFDB:Q5EBX5	0.220	0.044	1.820E-2	961	0.096	0.015	Q5EBX5.pdb.gz	Q5EBX5_MOUSE Mini-agrin OS=Mus musculus OX=10090 GN=Agrn PE=2 SV=1
13	AFDB:M9PE65	0.179	0.021	3.895E-2	2179	0.075	0.005	M9PE65.pdb.gz	AXO_DROME Axotactin OS=Drosophila melanogaster OX=7227 GN=axo PE=1 SV=1
14	PDB:3zxfB	0.196	0.203	6.460E-2	138	0.068	0.072	3zxfB.pdb.gz
15	PDB:1w6mA	0.154	0.162	6.849E-2	134	0.082	0.090	1w6mA.pdb.gz	Growth-Regulatory Human Galectin-1: Crystallographic Characterisation of the Structural Changes Induced by Single-Site Mutations and Their Impact on the Thermodynamics of Ligand Binding.
16	PDB:4ga9A	0.155	0.162	7.262E-2	134	0.096	0.104	4ga9A.pdb.gz	Gal-1 structure analysis
17	PDB:1cd1A	0.207	0.139	7.700E-2	273	0.123	0.066	1cd1A.pdb.gz
18	PDB:3cm1A	0.182	0.188	9.730E-2	137	0.082	0.088	3cm1A.pdb.gz
19	PDB:6l6aA	0.171	0.171	1.094E-1	142	0.082	0.085	6l6aA.pdb.gz	Structures of human galectin-10/monosaccharide complexes demonstrate potential of monosaccharides as effectors in forming Charcot-Leyden crystals.
20	PDB:3jcfA	0.152	0.088	1.382E-1	349	0.185	0.077	3jcfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61326	5.58e-106	300	146	1.000	1.000	MGN_HUMAN Protein mago nashi homolog OS=Homo sapiens OX=9606 GN=MAGOH PE=1 SV=1
2	F1M0X6	6.90e-105	297	148	0.986	0.973	F1M0X6_RAT Mago homolog B, exon junction complex subunit OS=Rattus norvegicus OX=10116 GN=Magohb PE=3 SV=2
3	Q96A72	9.70e-105	297	148	0.986	0.973	MGN2_HUMAN Protein mago nashi homolog 2 OS=Homo sapiens OX=9606 GN=MAGOHB PE=1 SV=1
4	P49028	1.57e-95	273	147	0.897	0.891	MGN_DROME Protein mago nashi OS=Drosophila melanogaster OX=7227 GN=mago PE=1 SV=1
5	P49030	1.37e-86	251	160	0.815	0.744	MGN2_ORYSJ Protein mago nashi homolog 2 OS=Oryza sativa subsp. japonica OX=39947 GN=MAGO2 PE=1 SV=2
6	P49029	4.77e-85	247	152	0.795	0.763	MGN_CAEEL Protein mago nashi homolog OS=Caenorhabditis elegans OX=6239 GN=mag-1 PE=1 SV=2
7	O23676	5.87e-83	242	150	0.767	0.747	MGN_ARATH Protein mago nashi homolog OS=Arabidopsis thaliana OX=3702 GN=MAGO PE=1 SV=1
8	O43037	1.35e-65	198	147	0.616	0.612	MGN_SCHPO Protein mago nashi homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnh1 PE=3 SV=1
9	Q586G7	4.22e-53	166	147	0.527	0.524	Q586G7_TRYB2 Mago nashi-like protein,putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.30P15.540 PE=3 SV=1
10	Q9SUG3	1.8	30.8	353	0.123	0.051	ITPK3_ARATH Inositol-tetrakisphosphate 1-kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ITPK3 PE=1 SV=2
11	P9WJM9	2.0	30.4	414	0.205	0.072	MSHC_MYCTU L-cysteine:1D-myo-inositol 2-amino-2-deoxy-alpha-D-glucopyranoside ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mshC PE=1 SV=1
12	O74405	4.6	29.6	381	0.110	0.042	SET11_SCHPO Ribosomal lysine N-methyltransferase set11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set11 PE=1 SV=1
13	P38835	5.8	29.3	850	0.082	0.014	YHT1_YEAST PH domain-containing protein YHR131C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHR131C PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02792 Mago_nashi	4.9e-74	258.5	Mago nashi protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 34839.XP_005373270.1

Rank	PPI partner	STRING score	Description
1	34839.XP_005413481.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns
2	34839.XP_005407387.1	0.996	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 26 mRNAs, 24 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
3	34839.XP_005394407.1	0.995	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
4	34839.XP_005410487.1	0.990	Regulator of nonsense transcripts 3B isoform X1
5	34839.XP_005397325.1	0.976	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
6	34839.XP_005374546.1	0.975	Small nuclear ribonucleoprotein F
7	34839.XP_005375336.1	0.973	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns
8	34839.XP_005391145.1	0.965	Serine/threonine-protein kinase SMG1 isoform X1
9	34839.XP_005385673.1	0.951	Small nuclear ribonucleoprotein G
10	34839.XP_005409751.1	0.948	Regulator of nonsense transcripts 1
11	34839.XP_005396449.1	0.938	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns
12	34839.XP_005387117.1	0.934	U6 snRNA-associated Sm-like protein LSm3
13	34839.XP_005373414.1	0.932	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 10 samples with support for all annotated introns
14	34839.XP_005383956.1	0.927	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 20 mRNAs, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
15	34839.XP_005378982.1	0.924	Protein mago nashi homolog 2 isoform X1
16	34839.XP_005402669.1	0.918	pre-mRNA-processing-splicing factor 8
17	34839.XP_005380809.1	0.916	Small nuclear ribonucleoprotein-associated proteins B and B' isoform X1
18	34839.XP_005392691.1	0.906	Peptidyl-prolyl cis-trans isomerase CWC27 homolog
19	34839.XP_005394610.1	0.904	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 mRNAs, 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
20	34839.XP_005391453.1	0.902	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 mRNAs, 20 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.612	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0006402	0.992	mRNA catabolic process
GO:0006396	0.988	RNA processing
GO:0008380	0.963	RNA splicing
GO:0006397	0.937	mRNA processing
GO:0000375	0.937	RNA splicing, via transesterification reactions
GO:0000377	0.931	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0000398	0.919	mRNA splicing, via spliceosome
GO:0000956	0.915	nuclear-transcribed mRNA catabolic process
GO:0000184	0.849	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0050794	0.794	regulation of cellular process
GO:0048518	0.502	positive regulation of biological process
GO:0080090	0.417	regulation of primary metabolic process
GO:0051171	0.417	regulation of nitrogen compound metabolic process
GO:0031323	0.413	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0140513	0.998	nuclear protein-containing complex
GO:0005654	0.996	nucleoplasm
GO:0035145	0.982	exon-exon junction complex
GO:1990904	0.957	ribonucleoprotein complex
GO:1902494	0.947	catalytic complex
GO:0005681	0.919	spliceosomal complex
GO:0005737	0.716	cytoplasm
GO:0005829	0.657	cytosol
GO:0071013	0.425	catalytic step 2 spliceosome
GO:0005684	0.423	U2-type spliceosomal complex
GO:0071011	0.349	precatalytic spliceosome
GO:0043232	0.348	intracellular non-membrane-bounded organelle
GO:0071005	0.313	U2-type precatalytic spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]