StarFunc result for job id P61328

User Input

>input (243 residues)
MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKR
PVRRRPEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQG
VKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKE
GQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQ
DST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61150	0.880	0.880	3.148E-42	243	1.000	1.000	P61150.pdb.gz	FGF12_RAT Fibroblast growth factor 12 OS=Rattus norvegicus OX=10116 GN=Fgf12 PE=1 SV=1
2	AFDB:P70379	0.647	0.636	4.288E-34	247	0.716	0.704	P70379.pdb.gz	FGF14_MOUSE Fibroblast growth factor 14 OS=Mus musculus OX=10090 GN=Fgf14 PE=2 SV=1
3	AFDB:A6P7H6	0.723	0.717	8.055E-32	245	0.658	0.653	A6P7H6.pdb.gz	FGF13_XENLA Fibroblast growth factor 13 OS=Xenopus laevis OX=8355 GN=fgf13 PE=2 SV=1
4	AFDB:Q92914	0.665	0.717	3.342E-27	225	0.551	0.596	Q92914.pdb.gz	FGF11_HUMAN Fibroblast growth factor 11 OS=Homo sapiens OX=9606 GN=FGF11 PE=1 SV=1
5	PDB:4jq0A	0.575	0.985	9.305E-23	141	0.580	1.000	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
6	AFDB:Q9EST9	0.526	0.601	3.545E-15	212	0.230	0.264	Q9EST9.pdb.gz	FGF20_RAT Fibroblast growth factor 20 OS=Rattus norvegicus OX=10116 GN=Fgf20 PE=2 SV=1
7	AFDB:Q2HXK8	0.534	0.637	5.762E-15	203	0.206	0.246	Q2HXK8.pdb.gz	FGF16_DANRE Fibroblast growth factor 16 OS=Danio rerio OX=7955 GN=fgf16 PE=2 SV=1
8	AFDB:O42407	0.532	0.608	7.547E-15	212	0.218	0.250	O42407.pdb.gz	O42407_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 PE=2 SV=2
9	AFDB:P31371	0.550	0.640	7.547E-15	208	0.235	0.274	P31371.pdb.gz	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
10	AFDB:P48807	0.511	0.469	7.965E-15	266	0.251	0.229	P48807.pdb.gz	FGF5_RAT Fibroblast growth factor 5 OS=Rattus norvegicus OX=10116 GN=Fgf5 PE=2 SV=1
11	AFDB:Q2LJ24	0.516	0.599	8.873E-15	208	0.206	0.240	Q2LJ24.pdb.gz	Q2LJ24_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf20b PE=2 SV=1
12	PDB:3f1rA	0.529	0.812	1.660E-14	157	0.206	0.318	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
13	PDB:1ry7A	0.489	0.774	3.415E-10	151	0.173	0.278	1ry7A.pdb.gz
14	PDB:6b0tA	0.436	0.227	1.142E-5	487	0.082	0.041	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
15	PDB:4qd2B	0.441	0.704	4.171E-5	143	0.070	0.119	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
16	PDB:1t9fA	0.424	0.564	4.732E-4	178	0.049	0.067	1t9fA.pdb.gz
17	PDB:7t3qA	0.384	0.054	4.995E-4	2103	0.111	0.013	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
18	PDB:7t3pA	0.367	0.051	7.692E-4	2066	0.107	0.013	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
19	PDB:7t3rA	0.368	0.050	8.119E-4	2130	0.119	0.014	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
20	PDB:3malA	0.408	0.536	9.044E-4	181	0.107	0.144	3malA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61150	0.0	503	243	1.000	1.000	FGF12_RAT Fibroblast growth factor 12 OS=Rattus norvegicus OX=10116 GN=Fgf12 PE=1 SV=1
2	P61328	0.0	503	243	1.000	1.000	FGF12_HUMAN Fibroblast growth factor 12 OS=Homo sapiens OX=9606 GN=FGF12 PE=1 SV=1
3	P61329	0.0	503	243	1.000	1.000	FGF12_MOUSE Fibroblast growth factor 12 OS=Mus musculus OX=10090 GN=Fgf12 PE=1 SV=1
4	Q8R5L7	6.95e-119	340	247	0.724	0.713	FGF14_RAT Fibroblast growth factor 14 OS=Rattus norvegicus OX=10116 GN=Fgf14 PE=2 SV=1
5	Q92915	9.34e-119	340	247	0.724	0.713	FGF14_HUMAN Fibroblast growth factor 14 OS=Homo sapiens OX=9606 GN=FGF14 PE=1 SV=1
6	P70379	4.31e-117	336	247	0.720	0.709	FGF14_MOUSE Fibroblast growth factor 14 OS=Mus musculus OX=10090 GN=Fgf14 PE=2 SV=1
7	A8K1P5	1.17e-111	322	245	0.679	0.673	A8K1P5_HUMAN Fibroblast growth factor OS=Homo sapiens OX=9606 GN=FGF13 PE=2 SV=1
8	Q92913	1.17e-111	322	245	0.679	0.673	FGF13_HUMAN Fibroblast growth factor 13 OS=Homo sapiens OX=9606 GN=FGF13 PE=1 SV=1
9	P70377	6.72e-111	320	245	0.679	0.673	FGF13_MOUSE Fibroblast growth factor 13 OS=Mus musculus OX=10090 GN=Fgf13 PE=1 SV=2
10	Q9ERW3	6.72e-111	320	245	0.679	0.673	FGF13_RAT Fibroblast growth factor 13 OS=Rattus norvegicus OX=10116 GN=Fgf13 PE=1 SV=2
11	A6P7H6	3.09e-109	316	245	0.687	0.682	FGF13_XENLA Fibroblast growth factor 13 OS=Xenopus laevis OX=8355 GN=fgf13 PE=2 SV=1
12	Q92914	2.08e-95	280	225	0.547	0.591	FGF11_HUMAN Fibroblast growth factor 11 OS=Homo sapiens OX=9606 GN=FGF11 PE=1 SV=1
13	Q2HXK8	8.94e-34	122	203	0.226	0.271	FGF16_DANRE Fibroblast growth factor 16 OS=Danio rerio OX=7955 GN=fgf16 PE=2 SV=1
14	Q9EST9	4.01e-33	121	212	0.226	0.259	FGF20_RAT Fibroblast growth factor 20 OS=Rattus norvegicus OX=10116 GN=Fgf20 PE=2 SV=1
15	Q9ESL9	1.21e-32	120	211	0.226	0.261	FGF20_MOUSE Fibroblast growth factor 20 OS=Mus musculus OX=10090 GN=Fgf20 PE=2 SV=2
16	P36364	2.22e-32	119	208	0.222	0.260	FGF9_RAT Fibroblast growth factor 9 OS=Rattus norvegicus OX=10116 GN=Fgf9 PE=2 SV=2
17	P54130	2.22e-32	119	208	0.222	0.260	FGF9_MOUSE Fibroblast growth factor 9 OS=Mus musculus OX=10090 GN=Fgf9 PE=2 SV=2
18	P31371	2.34e-32	119	208	0.222	0.260	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
19	Q9NP95	2.43e-32	119	211	0.222	0.256	FGF20_HUMAN Fibroblast growth factor 20 OS=Homo sapiens OX=9606 GN=FGF20 PE=1 SV=1
20	Q38PL0	7.50e-32	117	208	0.218	0.255	Q38PL0_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=dob PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06268 Fascin	75	15.0	Fascin domain
2	PF00167 FGF	5e-37	138.1	Fibroblast growth factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008846998.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008834401.1	0.882	Sodium channel protein type 5 subunit alpha
2	1026970.XP_008845991.1	0.733	Fibroblast growth factor receptor 1 isoform X1
3	1026970.XP_008841934.1	0.717	Epidermal growth factor
4	1026970.XP_008833006.1	0.710	C-Jun-amino-terminal kinase-interacting protein 2 isoform X1
5	1026970.XP_008825504.1	0.697	Fibroblast growth factor receptor 2
6	1026970.XP_008824338.1	0.694	BMP/retinoic acid inducible neural specific 2
7	1026970.XP_008824331.1	0.692	Ring finger and WD repeat domain 2
8	1026970.XP_008833512.1	0.692	GH3 domain-containing protein
9	1026970.XP_008839802.1	0.692	GC-rich sequence DNA-binding factor 2
10	1026970.XP_008842755.1	0.692	Syntaxin-binding protein 2
11	1026970.XP_008853839.1	0.692	Tax1-binding protein 3
12	1026970.XP_008848372.1	0.683	Integrator complex subunit 10
13	1026970.XP_008827211.1	0.673	Hepatocyte growth factor isoform X1
14	1026970.XP_008848572.1	0.671	Potassium voltage-gated channel subfamily A member 2
15	1026970.XP_008840510.1	0.670	Kelch like family member 22
16	1026970.XP_008823101.1	0.642	Prosaposin receptor GPR37
17	1026970.XP_008830827.1	0.641	Insulin-like growth factor I isoform X1
18	1026970.XP_008821273.1	0.639	Calmodulin
19	1026970.XP_008837426.1	0.637	Insulin isoform X1
20	1026970.XP_008839128.1	0.633	RB1-inducible coiled-coil protein 1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	0.998	growth factor activity
GO:0099106	0.425	ion channel regulator activity
GO:0017080	0.399	sodium channel regulator activity
GO:0044325	0.322	transmembrane transporter binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0032501	0.995	multicellular organismal process
GO:0050794	0.992	regulation of cellular process
GO:0002028	0.988	regulation of sodium ion transport
GO:0048856	0.985	anatomical structure development
GO:0007154	0.985	cell communication
GO:0023052	0.979	signaling
GO:0050896	0.975	response to stimulus
GO:0007275	0.971	multicellular organism development
GO:0042391	0.935	regulation of membrane potential
GO:0048731	0.933	system development
GO:0007267	0.926	cell-cell signaling
GO:0048518	0.861	positive regulation of biological process
GO:0065009	0.820	regulation of molecular function
GO:0048522	0.813	positive regulation of cellular process
GO:0032409	0.786	regulation of transporter activity
GO:0051716	0.781	cellular response to stimulus
GO:0006950	0.753	response to stress
GO:0051050	0.736	positive regulation of transport
GO:0000165	0.728	MAPK cascade
GO:0051403	0.675	stress-activated MAPK cascade
GO:0034762	0.671	regulation of transmembrane transport
GO:0051239	0.666	regulation of multicellular organismal process
GO:0043270	0.657	positive regulation of monoatomic ion transport
GO:0007399	0.653	nervous system development
GO:0048519	0.648	negative regulation of biological process
GO:0048523	0.619	negative regulation of cellular process
GO:0010765	0.614	positive regulation of sodium ion transport
GO:1904062	0.595	regulation of monoatomic cation transmembrane transport
GO:0099536	0.594	synaptic signaling
GO:0032412	0.584	regulation of monoatomic ion transmembrane transporter activity
GO:0010646	0.524	regulation of cell communication
GO:2001257	0.498	regulation of cation channel activity
GO:0023051	0.459	regulation of signaling
GO:0048513	0.449	animal organ development
GO:2000649	0.389	regulation of sodium ion transmembrane transporter activity
GO:0048869	0.388	cellular developmental process
GO:0030154	0.376	cell differentiation
GO:0042221	0.368	response to chemical
GO:0048583	0.336	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005634	0.991	nucleus
GO:0005576	0.960	extracellular region
GO:0005737	0.878	cytoplasm
GO:0005829	0.812	cytosol
GO:0005615	0.802	extracellular space
GO:0005886	0.444	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]