StarFunc result for job id P61366

User Input

>input (133 residues)
MLDWRLASAHFILAVTLTLWSSGKVLSVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTA
KLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPM
DRIGRNRLSNSRG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61366	1.000	1.000	2.318E-19	133	1.000	1.000	P61366.pdb.gz	OSTN_HUMAN Osteocrin OS=Homo sapiens OX=9606 GN=OSTN PE=1 SV=1
2	AFDB:P61364	0.290	0.295	1.091E-13	130	0.752	0.769	P61364.pdb.gz	OSTN_MOUSE Osteocrin OS=Mus musculus OX=10090 GN=Ostn PE=1 SV=1
3	AFDB:E7F404	0.245	0.243	3.898E-6	134	0.459	0.455	E7F404.pdb.gz	E7F404_DANRE Osteocrin OS=Danio rerio OX=7955 GN=ostn PE=4 SV=1
4	AFDB:Q9UJ90	0.194	0.182	2.896E-1	142	0.150	0.141	Q9UJ90.pdb.gz	KCNE5_HUMAN Potassium voltage-gated channel subfamily E regulatory beta subunit 5 OS=Homo sapiens OX=9606 GN=KCNE5 PE=1 SV=1
5	AFDB:H2KYI0	0.197	0.192	6.323E-1	166	0.203	0.163	H2KYI0.pdb.gz	H2KYI0_CAEEL Mid2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_D2024.5 PE=1 SV=1
6	AFDB:M0R9F7	0.177	0.074	9.018E-1	470	0.188	0.053	M0R9F7.pdb.gz	M0R9F7_RAT Macrophage receptor with collagenous structure OS=Rattus norvegicus OX=10116 GN=Marco PE=4 SV=3
7	AFDB:A0A024R260	0.210	0.138	9.681E-1	244	0.128	0.070	A0A024R260.pdb.gz
8	AFDB:O14244	0.177	0.048	1.039	778	0.090	0.015	O14244.pdb.gz	YELD_SCHPO Uncharacterized membrane protein C6F6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6F6.13c PE=3 SV=1
9	AFDB:Q9VX37	0.191	0.061	1.116	554	0.120	0.029	Q9VX37.pdb.gz	Q9VX37_DROME Corolla, isoform A OS=Drosophila melanogaster OX=7227 GN=corolla PE=2 SV=2
10	AFDB:Q9D3J8	0.131	0.096	1.198	213	0.128	0.080	Q9D3J8.pdb.gz	AMTN_MOUSE Amelotin OS=Mus musculus OX=10090 GN=Amtn PE=2 SV=1
11	PDB:6rqlA	0.126	0.016	9.945	1542	0.083	0.007	6rqlA.pdb.gz	Molecular insight into RNA polymerase I promoter recognition and promoter melting.
12	PDB:6yxyEQ	0.115	0.060	9.945	471	0.128	0.036	6yxyEQ.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61366	5.81e-93	266	133	1.000	1.000	OSTN_HUMAN Osteocrin OS=Homo sapiens OX=9606 GN=OSTN PE=1 SV=1
2	P61364	5.23e-68	203	130	0.752	0.769	OSTN_MOUSE Osteocrin OS=Mus musculus OX=10090 GN=Ostn PE=1 SV=1
3	E7F404	1.45e-27	100	134	0.429	0.425	E7F404_DANRE Osteocrin OS=Danio rerio OX=7955 GN=ostn PE=4 SV=1
4	Q7M753	10.0	28.1	456	0.083	0.024	PANK2_MOUSE Pantothenate kinase 2, mitochondrial OS=Mus musculus OX=10090 GN=Pank2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00212 ANP	7.3e+02	11.8	Atrial natriuretic peptide
2	PF11037 Musclin	1.3e-67	237.3	Insulin-resistance promoting peptide in skeletal muscle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342356

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265074	0.885	Atrial natriuretic peptide receptor 3
2	9606.ENSP00000246841	0.682	Leucine-rich repeat transmembrane protein FLRT1
3	9606.ENSP00000406164	0.675	Geminin coiled-coil domain-containing protein 1
4	9606.ENSP00000481046	0.675	Pyridoxal phosphate phosphatase PHOSPHO2
5	9606.ENSP00000357255	0.605	Osteocalcin
6	9606.ENSP00000295770	0.583	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B
7	9606.ENSP00000376472	0.574	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A
8	9606.ENSP00000357669	0.571	Atrial natriuretic peptide receptor 1
9	9606.ENSP00000340526	0.570	Urotensin-2B
10	9606.ENSP00000377043	0.555	Tubulin polyglutamylase TTLL6
11	9606.ENSP00000387159	0.529	C-type natriuretic peptide
12	9606.ENSP00000362570	0.520	Fibronectin type III domain-containing protein 5
13	9606.ENSP00000371180	0.508	Cation channel sperm-associated protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0051093	0.945	negative regulation of developmental process
GO:0048523	0.920	negative regulation of cellular process
GO:0040008	0.842	regulation of growth
GO:0009987	0.783	cellular process
GO:0022603	0.669	regulation of anatomical structure morphogenesis
GO:0045926	0.631	negative regulation of growth
GO:1903859	0.595	regulation of dendrite extension
GO:0050896	0.573	response to stimulus
GO:0032501	0.374	multicellular organismal process
GO:0051716	0.328	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005622	0.753	intracellular anatomical structure
GO:0005737	0.505	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]