StarFunc result for job id P61371

User Input

>input (349 residues)
MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFV
RDGKTYCKRDYIRLYGIKCAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEF
ALREDGLFCRADHDVVERASLGAGDPLSPLHPARPLQMAAEPISARQPALRPHVHKQPEK
TTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRS
IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQ
SDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P50211	0.824	0.824	1.893E-64	349	0.994	0.994	P50211.pdb.gz	ISL1_CHICK Insulin gene enhancer protein ISL-1 OS=Gallus gallus OX=9031 GN=ISL1 PE=1 SV=1
2	AFDB:Q96A47	0.609	0.596	3.512E-50	359	0.756	0.735	Q96A47.pdb.gz	ISL2_HUMAN Insulin gene enhancer protein ISL-2 OS=Homo sapiens OX=9606 GN=ISL2 PE=1 SV=1
3	AFDB:P53407	0.405	0.396	3.645E-44	358	0.745	0.726	P53407.pdb.gz	ISL2B_DANRE Insulin gene enhancer protein isl-2b OS=Danio rerio OX=7955 GN=isl2b PE=2 SV=1
4	AFDB:P53410	0.540	0.583	2.028E-43	319	0.659	0.721	P53410.pdb.gz	ISL2_CHICK Insulin gene enhancer protein ISL-2 (Fragment) OS=Gallus gallus OX=9031 GN=ISL2 PE=2 SV=1
5	AFDB:P53406	0.412	0.401	2.292E-43	359	0.774	0.752	P53406.pdb.gz	ISL2A_DANRE Insulin gene enhancer protein isl-2a OS=Danio rerio OX=7955 GN=isl2a PE=2 SV=1
6	AFDB:P92031	0.460	0.305	2.762E-36	534	0.579	0.378	P92031.pdb.gz	P92031_DROME LIM homeobox protein OS=Drosophila melanogaster OX=7227 GN=tup PE=2 SV=1
7	AFDB:G5EC36	0.445	0.351	1.038E-29	452	0.364	0.281	G5EC36.pdb.gz	LIM7_CAEEL LIM/homeobox protein lim-7 OS=Caenorhabditis elegans OX=6239 GN=lim-7 PE=1 SV=1
8	AFDB:P36198	0.290	0.243	3.672E-23	426	0.312	0.256	P36198.pdb.gz	LHX2_RAT LIM/homeobox protein Lhx2 OS=Rattus norvegicus OX=10116 GN=Lhx2 PE=2 SV=1
9	AFDB:O42108	0.323	0.289	7.870E-22	400	0.298	0.260	O42108.pdb.gz	O42108_CHICK LIM homeodomain OS=Gallus gallus OX=9031 GN=LH-2A PE=2 SV=1
10	AFDB:Q90881	0.312	0.280	1.746E-21	397	0.298	0.262	Q90881.pdb.gz	LHX9_CHICK LIM/homeobox protein Lhx9 OS=Gallus gallus OX=9031 GN=LHX9 PE=2 SV=2
11	PDB:4kfzB	0.191	0.402	4.529E-11	148	0.129	0.304	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
12	PDB:1b8tA	0.156	0.275	4.158E-5	192	0.086	0.156	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:1imlA	0.160	0.616	2.855E-3	76	0.063	0.289	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:4egcA	0.134	0.087	1.100E-2	539	0.054	0.035	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
15	PDB:5dkaA	0.084	0.258	2.833E-1	96	0.049	0.177	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
16	PDB:7dvq9	0.088	0.076	1.894	409	0.052	0.044	7dvq9.pdb.gz	Structure of the activated human minor spliceosome.
17	PDB:5a31B	0.082	0.276	2.420	84	0.029	0.119	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
18	PDB:5mrcHH	0.058	0.104	2.573	154	0.020	0.045	5mrcHH.pdb.gz	The structure of the yeast mitochondrial ribosome.
19	PDB:4kblA	0.096	0.087	2.909	395	0.057	0.051	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
20	PDB:7uhyD	0.111	0.132	2.909	288	0.034	0.042	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P50211	0.0	729	349	0.994	0.994	ISL1_CHICK Insulin gene enhancer protein ISL-1 OS=Gallus gallus OX=9031 GN=ISL1 PE=1 SV=1
2	P53405	0.0	720	349	0.980	0.980	ISL1_DANRE Insulin gene enhancer protein isl-1 OS=Danio rerio OX=7955 GN=isl1 PE=2 SV=1
3	P53406	0.0	550	359	0.774	0.752	ISL2A_DANRE Insulin gene enhancer protein isl-2a OS=Danio rerio OX=7955 GN=isl2a PE=2 SV=1
4	P53407	0.0	531	358	0.754	0.735	ISL2B_DANRE Insulin gene enhancer protein isl-2b OS=Danio rerio OX=7955 GN=isl2b PE=2 SV=1
5	P61371	0.0	731	349	1.000	1.000	ISL1_HUMAN Insulin gene enhancer protein ISL-1 OS=Homo sapiens OX=9606 GN=ISL1 PE=1 SV=1
6	P61372	0.0	731	349	1.000	1.000	ISL1_MOUSE Insulin gene enhancer protein ISL-1 OS=Mus musculus OX=10090 GN=Isl1 PE=1 SV=1
7	P61374	0.0	731	349	1.000	1.000	ISL1_RAT Insulin gene enhancer protein ISL-1 OS=Rattus norvegicus OX=10116 GN=Isl1 PE=1 SV=1
8	Q96A47	0.0	538	359	0.756	0.735	ISL2_HUMAN Insulin gene enhancer protein ISL-2 OS=Homo sapiens OX=9606 GN=ISL2 PE=1 SV=1
9	Q9CXV0	0.0	532	359	0.745	0.724	ISL2_MOUSE Insulin gene enhancer protein ISL-2 OS=Mus musculus OX=10090 GN=Isl2 PE=1 SV=2
10	P53410	2.43e-156	443	319	0.653	0.715	ISL2_CHICK Insulin gene enhancer protein ISL-2 (Fragment) OS=Gallus gallus OX=9031 GN=ISL2 PE=2 SV=1
11	Q9Y0Z9	1.08e-136	398	465	0.579	0.434	Q9Y0Z9_DROME Tailup OS=Drosophila melanogaster OX=7227 GN=tup PE=2 SV=1
12	Q9VJ37	3.02e-136	400	534	0.579	0.378	Q9VJ37_DROME Tailup, isoform A OS=Drosophila melanogaster OX=7227 GN=tup PE=4 SV=1
13	P92031	3.49e-135	397	534	0.573	0.375	P92031_DROME LIM homeobox protein OS=Drosophila melanogaster OX=7227 GN=tup PE=2 SV=1
14	G5EC36	5.48e-66	217	452	0.350	0.270	LIM7_CAEEL LIM/homeobox protein lim-7 OS=Caenorhabditis elegans OX=6239 GN=lim-7 PE=1 SV=1
15	B0R107	1.00e-51	179	427	0.298	0.244	B0R107_DANRE LIM homeobox 2b OS=Danio rerio OX=7955 GN=bel PE=4 SV=1
16	Q9NQ69	1.82e-50	175	397	0.275	0.242	LHX9_HUMAN LIM/homeobox protein Lhx9 OS=Homo sapiens OX=9606 GN=LHX9 PE=1 SV=3
17	Q9WUH2	3.06e-50	174	397	0.275	0.242	LHX9_MOUSE LIM/homeobox protein Lhx9 OS=Mus musculus OX=10090 GN=Lhx9 PE=1 SV=3
18	Q1LWV4	9.45e-50	173	396	0.261	0.230	LHX9_DANRE LIM/homeobox protein Lhx9 OS=Danio rerio OX=7955 GN=lhx9 PE=2 SV=1
19	O42108	5.36e-49	171	400	0.281	0.245	O42108_CHICK LIM homeodomain OS=Gallus gallus OX=9031 GN=LH-2A PE=2 SV=1
20	Q90881	8.67e-49	170	397	0.266	0.234	LHX9_CHICK LIM/homeobox protein Lhx9 OS=Gallus gallus OX=9031 GN=LHX9 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	0.092	24.0	Homeobox KN domain
2	PF00046 Homeodomain	8.7e-12	56.0	Homeodomain
3	PF00412 LIM	6.2e-24	95.3	LIM domain
4	PF13411 MerR_1	3.5e+02	12.7	MerR HTH family regulatory protein
5	PF17466 NinD	5.5e+02	12.1	Family of unknown function

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 30611.ENSOGAP00000020197

Rank	PPI partner	STRING score	Description
1	30611.ENSOGAP00000014633	0.960	LIM domain binding 1
2	30611.ENSOGAP00000014383	0.924	LIM homeobox 4
3	30611.ENSOGAP00000002195	0.923	LIM domain binding 2
4	30611.ENSOGAP00000000647	0.921	LIM homeobox 3
5	30611.ENSOGAP00000002280	0.862	Single-stranded DNA binding protein 2
6	30611.ENSOGAP00000016128	0.762	GATA binding protein 4
7	30611.ENSOGAP00000014844	0.755	Single stranded DNA binding protein 3
8	30611.ENSOGAP00000006649	0.731	Single stranded DNA binding protein 4
9	30611.ENSOGAP00000007038	0.729	Paired box 6
10	30611.ENSOGAP00000017187	0.722	Myocyte enhancer factor 2C
11	30611.ENSOGAP00000016471	0.721	NK2 homeobox 5
12	30611.ENSOGAP00000021379	0.717	Neurogenic differentiation factor
13	30611.ENSOGAP00000006250	0.716	Orthodenticle homeobox 2
14	30611.ENSOGAP00000017651	0.715	NK2 homeobox 2
15	30611.ENSOGAP00000014508	0.711	T-box 5
16	30611.ENSOGAP00000000027	0.697	NK6 homeobox 1
17	30611.ENSOGAP00000009245	0.695	T-box 20
18	30611.ENSOGAP00000016683	0.689	POU domain protein
19	30611.ENSOGAP00000018416	0.683	Motor neuron and pancreas homeobox 1
20	30611.ENSOGAP00000021515	0.680	Isopentenyl-diphosphate delta isomerase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.978	cis-regulatory region sequence-specific DNA binding
GO:0008134	0.975	transcription factor binding
GO:0000978	0.944	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140297	0.806	DNA-binding transcription factor binding
GO:0001216	0.635	DNA-binding transcription activator activity
GO:0001228	0.583	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0061629	0.510	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0032502	0.995	developmental process
GO:0007275	0.993	multicellular organism development
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0010468	0.973	regulation of gene expression
GO:0030154	0.967	cell differentiation
GO:0048522	0.965	positive regulation of cellular process
GO:0048731	0.964	system development
GO:0031323	0.962	regulation of cellular metabolic process
GO:0051171	0.960	regulation of nitrogen compound metabolic process
GO:0080090	0.959	regulation of primary metabolic process
GO:0009889	0.952	regulation of biosynthetic process
GO:0019219	0.952	regulation of nucleobase-containing compound metabolic process
GO:0048513	0.925	animal organ development
GO:0009893	0.924	positive regulation of metabolic process
GO:0007399	0.899	nervous system development
GO:0051252	0.868	regulation of RNA metabolic process
GO:0010604	0.847	positive regulation of macromolecule metabolic process
GO:0010556	0.845	regulation of macromolecule biosynthetic process
GO:0006355	0.841	regulation of DNA-templated transcription
GO:0050896	0.822	response to stimulus
GO:0006357	0.769	regulation of transcription by RNA polymerase II
GO:0022008	0.764	neurogenesis
GO:0009653	0.707	anatomical structure morphogenesis
GO:0031325	0.702	positive regulation of cellular metabolic process
GO:0051173	0.696	positive regulation of nitrogen compound metabolic process
GO:0009891	0.656	positive regulation of biosynthetic process
GO:0031328	0.648	positive regulation of cellular biosynthetic process
GO:0048519	0.620	negative regulation of biological process
GO:0045935	0.579	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.575	positive regulation of macromolecule biosynthetic process
GO:0051254	0.574	positive regulation of RNA metabolic process
GO:0048699	0.561	generation of neurons
GO:0045893	0.551	positive regulation of DNA-templated transcription
GO:0030182	0.534	neuron differentiation
GO:0048523	0.529	negative regulation of cellular process
GO:0048468	0.511	cell development
GO:0071840	0.454	cellular component organization or biogenesis
GO:0009888	0.452	tissue development
GO:0051239	0.446	regulation of multicellular organismal process
GO:0045944	0.438	positive regulation of transcription by RNA polymerase II
GO:0016043	0.434	cellular component organization
GO:0050793	0.414	regulation of developmental process
GO:0042221	0.406	response to chemical
GO:0051716	0.380	cellular response to stimulus
GO:0009892	0.335	negative regulation of metabolic process
GO:0010605	0.328	negative regulation of macromolecule metabolic process
GO:0048666	0.319	neuron development
GO:0009887	0.316	animal organ morphogenesis
GO:0007417	0.311	central nervous system development
GO:0072359	0.308	circulatory system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.516	intracellular organelle lumen
GO:0031981	0.494	nuclear lumen
GO:0005654	0.334	nucleoplasm
GO:0043232	0.307	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]