StarFunc result for job id P61457

User Input

>input (104 residues)
MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKL
DHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61457	1.000	1.000	1.131E-21	104	1.000	1.000	P61457.pdb.gz	PHS_HUMAN Pterin-4-alpha-carbinolamine dehydratase OS=Homo sapiens OX=9606 GN=PCBD1 PE=1 SV=2
2	PDB:1f93A	0.954	0.963	2.540E-18	103	0.981	0.990	1f93A.pdb.gz	Structural basis of dimerization, coactivator recognition and MODY3 mutations in HNF-1alpha.
3	AFDB:Q9CZL5	0.946	0.726	4.429E-16	136	0.654	0.500	Q9CZL5.pdb.gz	PHS2_MOUSE Pterin-4-alpha-carbinolamine dehydratase 2 OS=Mus musculus OX=10090 GN=Pcbd2 PE=1 SV=2
4	AFDB:Q9H0N5	0.902	0.725	8.995E-14	130	0.596	0.477	Q9H0N5.pdb.gz	PHS2_HUMAN Pterin-4-alpha-carbinolamine dehydratase 2 OS=Homo sapiens OX=9606 GN=PCBD2 PE=1 SV=4
5	AFDB:O42658	0.795	0.858	6.789E-11	96	0.423	0.458	O42658.pdb.gz	PHS_SCHPO Pterin-4-alpha-carbinolamine dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omt2 PE=3 SV=1
6	AFDB:Q384W7	0.850	0.719	1.009E-8	124	0.317	0.266	Q384W7.pdb.gz	Q384W7_TRYB2 4a-hydroxytetrahydrobiopterin dehydratase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4890 PE=3 SV=1
7	AFDB:Q5ACY8	0.830	0.762	7.938E-8	114	0.250	0.228	Q5ACY8.pdb.gz	Q5ACY8_CANAL 4a-hydroxytetrahydrobiopterin dehydratase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHHB PE=3 SV=1
8	AFDB:Q6QJ72	0.741	0.435	1.019E-7	187	0.269	0.150	Q6QJ72.pdb.gz	PDL2_ARATH Pterin-4-alpha-carbinolamine dehydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDL2 PE=1 SV=1
9	AFDB:P38744	0.868	0.755	4.293E-7	120	0.260	0.225	P38744.pdb.gz	PHS_YEAST Putative pterin-4-alpha-carbinolamine dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHL018W PE=1 SV=1
10	AFDB:Q9LU63	0.731	0.369	2.181E-6	220	0.221	0.105	Q9LU63.pdb.gz	ATP1_ARATH Probable pterin-4-alpha-carbinolamine dehydratase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ATP1 PE=1 SV=1
11	AFDB:Q57TV8	0.618	0.244	8.809E-4	273	0.173	0.066	Q57TV8.pdb.gz	Q57TV8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.320 PE=4 SV=1
12	PDB:4wx8B	0.387	0.463	1.115E-1	84	0.077	0.095	4wx8B.pdb.gz
13	PDB:6gwjB	0.484	0.572	1.187E-1	84	0.106	0.131	6gwjB.pdb.gz	Defects in t 6 A tRNA modification due to GON7 and YRDC mutations lead to Galloway-Mowat syndrome.
14	PDB:7o9mf	0.371	0.311	1.345E-1	130	0.125	0.100	7o9mf.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
15	PDB:7a67A	0.496	0.615	1.622E-1	80	0.087	0.113	7a67A.pdb.gz
16	PDB:7qi4f	0.390	0.279	1.727E-1	157	0.115	0.076	7qi4f.pdb.gz	Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
17	PDB:2qb6A	0.353	0.127	1.957E-1	393	0.115	0.031	2qb6A.pdb.gz	The crystal structure of the cytosolic exopolyphosphatase from Saccharomyces cerevisiae reveals the basis for substrate specificity.
18	PDB:7aocK	0.405	0.430	2.218E-1	95	0.067	0.074	7aocK.pdb.gz	Conserved strategies of RNA polymerase I hibernation and activation.
19	PDB:5a0mB	0.278	0.164	2.361E-1	227	0.173	0.079	5a0mB.pdb.gz	Structure of the I-Scei Nuclease Complexed with its DsDNA Target and Three Catalytic Metal Ions.
20	PDB:5iy6K	0.433	0.397	3.435E-1	117	0.096	0.085	5iy6K.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61457	4.33e-75	218	104	1.000	1.000	PHS_HUMAN Pterin-4-alpha-carbinolamine dehydratase OS=Homo sapiens OX=9606 GN=PCBD1 PE=1 SV=2
2	P61459	4.33e-75	218	104	1.000	1.000	PHS_RAT Pterin-4-alpha-carbinolamine dehydratase OS=Rattus norvegicus OX=10116 GN=Pcbd1 PE=1 SV=2
3	P61458	1.28e-74	217	104	0.990	0.990	PHS_MOUSE Pterin-4-alpha-carbinolamine dehydratase OS=Mus musculus OX=10090 GN=Pcbd1 PE=1 SV=2
4	Q9CZL5	3.49e-51	159	136	0.654	0.500	PHS2_MOUSE Pterin-4-alpha-carbinolamine dehydratase 2 OS=Mus musculus OX=10090 GN=Pcbd2 PE=1 SV=2
5	Q9H0N5	7.13e-47	148	130	0.606	0.485	PHS2_HUMAN Pterin-4-alpha-carbinolamine dehydratase 2 OS=Homo sapiens OX=9606 GN=PCBD2 PE=1 SV=4
6	O42658	3.49e-26	95.1	96	0.404	0.438	PHS_SCHPO Pterin-4-alpha-carbinolamine dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omt2 PE=3 SV=1
7	Q384W7	4.70e-13	62.4	124	0.317	0.266	Q384W7_TRYB2 4a-hydroxytetrahydrobiopterin dehydratase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4890 PE=3 SV=1
8	Q6QJ72	2.57e-06	45.8	187	0.269	0.150	PDL2_ARATH Pterin-4-alpha-carbinolamine dehydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDL2 PE=1 SV=1
9	P38744	2.39e-05	42.4	120	0.221	0.192	PHS_YEAST Putative pterin-4-alpha-carbinolamine dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHL018W PE=1 SV=1
10	Q5ACY8	5.31e-05	41.2	114	0.192	0.175	Q5ACY8_CANAL 4a-hydroxytetrahydrobiopterin dehydratase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHHB PE=3 SV=1
11	Q86VW0	1.1	30.4	696	0.240	0.036	SESD1_HUMAN SEC14 domain and spectrin repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=SESTD1 PE=1 SV=2
12	Q7SX85	3.2	28.9	714	0.202	0.029	SESD1_DANRE SEC14 domain and spectrin repeat-containing protein 1 OS=Danio rerio OX=7955 GN=sestd1 PE=2 SV=3
13	A0A077K8G3	4.1	28.5	407	0.135	0.034	CGT1A_CITLI Coumarin 8-geranyltransferase 1, chloroplastic OS=Citrus limon OX=2708 GN=ClPT1 PE=1 SV=1
14	A0A077K9K6	4.1	28.5	407	0.135	0.034	CGT1B_CITLI Coumarin 8-geranyltransferase 1b, chloroplastic OS=Citrus limon OX=2708 GN=Cl-PT1b PE=1 SV=1
15	Q5T196	4.5	28.5	456	0.221	0.050	Q5T196_HUMAN Fad1, flavin adenine dinucleotide synthetase, homolog (Yeast), isoform CRA_e OS=Homo sapiens OX=9606 GN=FLAD1 PE=1 SV=1
16	Q8NFF5	4.6	28.5	587	0.221	0.039	FAD1_HUMAN FAD synthase OS=Homo sapiens OX=9606 GN=FLAD1 PE=1 SV=1
17	Q7RXM0	4.7	28.5	829	0.096	0.012	Q7RXM0_NEUCR Cellobiose dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=cdh-1 PE=1 SV=1
18	Q586C6	4.8	28.5	307	0.183	0.062	Q586C6_TRYB2 Peptidase S1 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.285 PE=4 SV=1
19	P12383	4.9	28.5	1068	0.115	0.011	PDR1_YEAST Transcription factor PDR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PDR1 PE=1 SV=2
20	Q5TCX8	4.9	28.5	1036	0.125	0.013	M3K21_HUMAN Mitogen-activated protein kinase kinase kinase 21 OS=Homo sapiens OX=9606 GN=MAP3K21 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01329 Pterin_4a	6.1e-28	108.1	Pterin 4 alpha carbinolamine dehydratase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008834875.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008825090.1	0.998	Dihydropteridine reductase
2	1026970.XP_008830824.1	0.997	Phenylalanine-4-hydroxylase
3	1026970.XP_008845948.1	0.983	Pterin-4-alpha-carbinolamine dehydratase 2 isoform X1
4	1026970.XP_008838915.1	0.975	HNF1 homeobox A
5	1026970.XP_008831619.1	0.962	Tryptophan 5-hydroxylase 1
6	1026970.XP_008832773.1	0.960	Tryptophan 5-hydroxylase 2
7	1026970.XP_008837425.1	0.960	Tyrosine 3-monooxygenase
8	1026970.XP_008846331.1	0.871	HNF1 homeobox B
9	1026970.XP_008840111.1	0.703	UDP-N-acetylglucosamine pyrophosphorylase 1 like 1
10	1026970.XP_008852191.1	0.660	Dual specificity tyrosine-phosphorylation-regulated kinase 1B isoform X1
11	1026970.XP_008836103.1	0.645	Small nuclear ribonucleoprotein Sm D3
12	1026970.XP_008834877.1	0.643	Sphingosine-1-phosphate lyase 1
13	1026970.XP_008844162.1	0.643	Enhancer of rudimentary homolog
14	1026970.XP_008834871.1	0.630	Solute carrier family 29 member 3
15	1026970.XP_008829330.1	0.624	Muscle associated receptor tyrosine kinase
16	1026970.XP_008844992.1	0.622	GTP cyclohydrolase 1 feedback regulatory protein isoform X1
17	1026970.XP_008852507.1	0.605	Fibrinogen beta chain isoform X1
18	1026970.XP_008848911.1	0.594	CTD phosphatase subunit 1
19	1026970.XP_008837765.1	0.587	GTP cyclohydrolase 1
20	1026970.XP_008846296.1	0.586	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: added 258 bases not found in genome assembly

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003713	0.999	transcription coactivator activity
GO:0003824	0.997	catalytic activity
GO:0042802	0.994	identical protein binding
GO:0016491	0.887	oxidoreductase activity
GO:0004497	0.868	monooxygenase activity
GO:0016714	0.832	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0044238	0.987	primary metabolic process
GO:1901564	0.986	organonitrogen compound metabolic process
GO:1901360	0.985	organic cyclic compound metabolic process
GO:0044281	0.984	small molecule metabolic process
GO:0006725	0.984	cellular aromatic compound metabolic process
GO:0051171	0.977	regulation of nitrogen compound metabolic process
GO:0048522	0.977	positive regulation of cellular process
GO:0031323	0.977	regulation of cellular metabolic process
GO:0080090	0.976	regulation of primary metabolic process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0019752	0.969	carboxylic acid metabolic process
GO:0045893	0.965	positive regulation of DNA-templated transcription
GO:0006520	0.929	amino acid metabolic process
GO:0009072	0.911	aromatic amino acid metabolic process
GO:0006558	0.842	L-phenylalanine metabolic process
GO:0051098	0.747	regulation of binding
GO:0043393	0.605	regulation of protein binding
GO:0009058	0.413	biosynthetic process
GO:0046483	0.377	heterocycle metabolic process
GO:0034641	0.305	cellular nitrogen compound metabolic process
GO:0044249	0.304	cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.965	cytoplasm
GO:0070013	0.940	intracellular organelle lumen
GO:0031981	0.877	nuclear lumen
GO:0005829	0.857	cytosol
GO:0005654	0.620	nucleoplasm
GO:0031982	0.364	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.887	Oxidoreductases.
EC:1.14.16.-	0.832	With reduced pteridine as one donor, and incorporation of one atom of oxygen.

[back to server]