StarFunc result for job id P61586

User Input

>input (193 residues)
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6DHM9	0.987	0.987	2.376E-41	193	0.959	0.959	Q6DHM9.pdb.gz	RHOAB_DANRE Rho-related GTP-binding protein RhoA-B OS=Danio rerio OX=7955 GN=rhoab PE=1 SV=1
2	AFDB:P48148	0.976	0.981	2.866E-39	192	0.865	0.870	P48148.pdb.gz	RHO1_DROME Ras-like GTP-binding protein Rho1 OS=Drosophila melanogaster OX=7227 GN=Rho1 PE=1 SV=1
3	AFDB:Q22038	0.973	0.978	3.053E-39	192	0.876	0.880	Q22038.pdb.gz	RHO1_CAEEL Ras-like GTP-binding protein rhoA OS=Caenorhabditis elegans OX=6239 GN=rho-1 PE=1 SV=1
4	AFDB:P62745	0.962	0.947	7.381E-39	196	0.850	0.837	P62745.pdb.gz	RHOB_HUMAN Rho-related GTP-binding protein RhoB OS=Homo sapiens OX=9606 GN=RHOB PE=1 SV=1
5	AFDB:B2RYP0	0.949	0.949	1.901E-38	193	0.912	0.912	B2RYP0.pdb.gz	B2RYP0_RAT Ras homolog family member C OS=Rattus norvegicus OX=10116 GN=Rhoc PE=1 SV=1
6	PDB:5c2kA	0.939	0.476	6.118E-38	382	0.953	0.482	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
7	PDB:6hxuA	0.928	0.984	6.928E-36	182	0.819	0.868	6hxuA.pdb.gz	A Targeted Protein Degradation Cell-Based Screening for Nanobodies Selective toward the Cellular RHOB GTP-Bound Conformation.
8	AFDB:A0A068C8U8	0.979	0.979	1.957E-35	193	0.725	0.725	A0A068C8U8.pdb.gz	A0A068C8U8_ASPFU Rho GTPase Rho1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=rho1 PE=1 SV=1
9	AFDB:Q09914	0.921	0.880	2.765E-34	202	0.699	0.668	Q09914.pdb.gz	RHO1_SCHPO GTP-binding protein rho1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rho1 PE=1 SV=1
10	AFDB:Q9HE04	0.927	0.895	5.030E-33	200	0.663	0.640	Q9HE04.pdb.gz	RHO5_SCHPO GTP-binding protein rho5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rho5 PE=3 SV=1
11	AFDB:Q6FQ78	0.942	0.867	7.343E-33	210	0.694	0.638	Q6FQ78.pdb.gz	Q6FQ78_CANGA Candida glabrata strain CBS138 chromosome I complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=RHO1 PE=4 SV=1
12	AFDB:J9VT08	0.963	0.944	8.330E-33	197	0.715	0.701	J9VT08.pdb.gz	J9VT08_CRYNH GTP-binding protein rhoA OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_03315 PE=4 SV=1
13	PDB:5jcpA	0.837	0.448	2.288E-31	361	0.834	0.446	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
14	PDB:6jikA	0.918	0.973	3.340E-31	182	0.684	0.725	6jikA.pdb.gz	Aspergillus fumigatus Rho1 gSGTP complex
15	PDB:3a58F	0.923	0.984	5.356E-30	181	0.684	0.729	3a58F.pdb.gz	Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3
16	PDB:6ukaA	0.888	0.967	5.011E-26	177	0.518	0.565	6ukaA.pdb.gz	Structure of the DOCK2-ELMO1 complex provides insights into regulation of the auto-inhibited state.
17	PDB:2wkpA	0.899	0.545	1.374E-25	320	0.523	0.316	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
18	PDB:1nf3A	0.903	0.899	2.582E-25	194	0.497	0.495	1nf3A.pdb.gz	Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6
19	PDB:4mitC	0.906	0.966	3.120E-25	181	0.461	0.492	4mitC.pdb.gz	Entamoeba histolytica RacC Selectively Engages p21-Activated Kinase Effectors.
20	PDB:2atxA	0.886	0.918	1.556E-23	186	0.497	0.516	2atxA.pdb.gz	An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	I3LVS7	4.27e-144	400	193	1.000	1.000	I3LVS7_PIG Ras homolog family member A OS=Sus scrofa OX=9823 GN=RHOA PE=1 SV=1
2	P61586	4.27e-144	400	193	1.000	1.000	RHOA_HUMAN Transforming protein RhoA OS=Homo sapiens OX=9606 GN=RHOA PE=1 SV=1
3	P61589	5.32e-144	400	193	0.995	0.995	RHOA_RAT Transforming protein RhoA OS=Rattus norvegicus OX=10116 GN=Rhoa PE=1 SV=1
4	Q9QUI0	5.32e-144	400	193	0.995	0.995	RHOA_MOUSE Transforming protein RhoA OS=Mus musculus OX=10090 GN=Rhoa PE=1 SV=1
5	G1MTS2	1.04e-143	399	193	0.995	0.995	G1MTS2_MELGA Ras homolog family member A OS=Meleagris gallopavo OX=9103 PE=4 SV=1
6	O93467	1.04e-143	399	193	0.995	0.995	O93467_CHICK GTP-binding protein OS=Gallus gallus OX=9031 GN=cRhoA PE=2 SV=1
7	F1CG58	2.73e-143	398	193	0.990	0.990	F1CG58_MELGA RhoA OS=Meleagris gallopavo OX=9103 GN=rhoA PE=2 SV=1
8	Q6DHM9	3.67e-138	385	193	0.959	0.959	RHOAB_DANRE Rho-related GTP-binding protein RhoA-B OS=Danio rerio OX=7955 GN=rhoab PE=1 SV=1
9	P08134	5.48e-134	374	193	0.917	0.917	RHOC_HUMAN Rho-related GTP-binding protein RhoC OS=Homo sapiens OX=9606 GN=RHOC PE=1 SV=1
10	Q62159	5.48e-134	374	193	0.917	0.917	RHOC_MOUSE Rho-related GTP-binding protein RhoC OS=Mus musculus OX=10090 GN=Rhoc PE=1 SV=2
11	B2RYP0	2.23e-133	373	193	0.912	0.912	B2RYP0_RAT Ras homolog family member C OS=Rattus norvegicus OX=10116 GN=Rhoc PE=1 SV=1
12	O35791	3.62e-130	364	174	0.902	1.000	O35791_RAT RhoA (Fragment) OS=Rattus norvegicus OX=10116 GN=Rhoa PE=2 SV=1
13	P48148	1.95e-124	350	192	0.865	0.870	RHO1_DROME Ras-like GTP-binding protein Rho1 OS=Drosophila melanogaster OX=7227 GN=Rho1 PE=1 SV=1
14	Q22038	5.66e-122	344	192	0.876	0.880	RHO1_CAEEL Ras-like GTP-binding protein rhoA OS=Caenorhabditis elegans OX=6239 GN=rho-1 PE=1 SV=1
15	P62745	3.73e-121	342	196	0.845	0.832	RHOB_HUMAN Rho-related GTP-binding protein RhoB OS=Homo sapiens OX=9606 GN=RHOB PE=1 SV=1
16	P62746	3.73e-121	342	196	0.845	0.832	RHOB_MOUSE Rho-related GTP-binding protein RhoB OS=Mus musculus OX=10090 GN=Rhob PE=1 SV=1
17	P62747	3.73e-121	342	196	0.845	0.832	RHOB_RAT Rho-related GTP-binding protein RhoB OS=Rattus norvegicus OX=10116 GN=Rhob PE=1 SV=1
18	A0A068C8U8	9.17e-103	296	193	0.725	0.725	A0A068C8U8_ASPFU Rho GTPase Rho1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=rho1 PE=1 SV=1
19	Q9C3Y4	1.25e-101	293	193	0.715	0.715	RHOA_EMENI GTP-binding protein rhoA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhoA PE=3 SV=1
20	P06780	3.46e-97	282	209	0.705	0.651	RHO1_YEAST GTP-binding protein RHO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RHO1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00025 Arf	1.2e-06	39.6	ADP-ribosylation factor family
2	PF00009 GTP_EFTU	0.82	20.7	Elongation factor Tu GTP binding domain
3	PF04670 Gtr1_RagA	2e+02	12.7	Gtr1/RagA G protein conserved region
4	PF00071 Ras	4.4e-55	197.2	Ras family
5	PF08477 Roc	2.5e-19	81.0	Ras of Complex, Roc, domain of DAPkinase
6	PF09439 SRPRB	1.3e+02	13.4	Signal recognition particle receptor beta subunit
7	PF08776 VASP_tetra	5.7e+02	11.5	VASP tetramerisation domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9478.XP_008047756.1

Rank	PPI partner	STRING score	Description
1	9478.XP_008058609.1	0.995	Rho GDP-dissociation inhibitor 1 isoform X1
2	9478.XP_008061928.1	0.986	A-kinase anchor protein 13
3	9478.XP_008052930.1	0.984	Serine/threonine-protein kinase N1
4	9478.XP_008063543.1	0.984	Rho GTPase-activating protein 1
5	9478.XP_008068428.1	0.981	Rho-associated protein kinase 1 isoform X1
6	9478.XP_008063735.1	0.976	Rho-associated protein kinase 2
7	9478.XP_008046531.1	0.971	Rho guanine nucleotide exchange factor 2 isoform X1
8	9478.XP_008062562.1	0.970	Rhotekin isoform X1
9	9478.XP_008066253.1	0.969	Disheveled-associated activator of morphogenesis 1 isoform X1
10	9478.XP_008069400.1	0.969	Rho GDP-dissociation inhibitor 2
11	9478.XP_008047993.1	0.960	Rho guanine nucleotide exchange factor 11
12	9478.XP_008060079.1	0.960	Rho guanine nucleotide exchange factor 11-like
13	9478.XP_008050065.1	0.959	Rho guanine nucleotide exchange factor 12-like
14	9478.XP_008057619.1	0.959	Rho guanine nucleotide exchange factor 12
15	9478.XP_008059086.1	0.957	Phospholipase D1 isoform X1
16	9478.XP_008053677.1	0.953	Catenin delta-1
17	9478.XP_008063480.1	0.952	Rho guanine nucleotide exchange factor 28 isoform X1
18	9478.XP_008057072.1	0.948	Tubulin alpha-4A chain
19	9478.XP_008050969.1	0.947	Disheveled-associated activator of morphogenesis 2
20	9478.XP_008072014.1	0.947	Angiotensin-converting enzyme-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003924	1.000	GTPase activity
GO:0005525	0.995	GTP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050794	0.983	regulation of cellular process
GO:0050896	0.976	response to stimulus
GO:0048518	0.952	positive regulation of biological process
GO:0048856	0.950	anatomical structure development
GO:0032970	0.930	regulation of actin filament-based process
GO:0016043	0.925	cellular component organization
GO:0048870	0.873	cell motility
GO:0032501	0.867	multicellular organismal process
GO:0048583	0.824	regulation of response to stimulus
GO:0051716	0.823	cellular response to stimulus
GO:0110053	0.811	regulation of actin filament organization
GO:0051495	0.795	positive regulation of cytoskeleton organization
GO:0065008	0.788	regulation of biological quality
GO:0007154	0.787	cell communication
GO:0110020	0.787	regulation of actomyosin structure organization
GO:0023052	0.786	signaling
GO:0007165	0.782	signal transduction
GO:0009653	0.780	anatomical structure morphogenesis
GO:0044087	0.778	regulation of cellular component biogenesis
GO:1902905	0.767	positive regulation of supramolecular fiber organization
GO:0009888	0.758	tissue development
GO:0007275	0.746	multicellular organism development
GO:0051492	0.742	regulation of stress fiber assembly
GO:0040012	0.737	regulation of locomotion
GO:0031032	0.732	actomyosin structure organization
GO:0009966	0.730	regulation of signal transduction
GO:0042060	0.725	wound healing
GO:0032233	0.712	positive regulation of actin filament bundle assembly
GO:0035556	0.709	intracellular signal transduction
GO:0016477	0.703	cell migration
GO:0051496	0.688	positive regulation of stress fiber assembly
GO:0048731	0.676	system development
GO:0007265	0.674	Ras protein signal transduction
GO:0048729	0.671	tissue morphogenesis
GO:0045595	0.671	regulation of cell differentiation
GO:0030154	0.660	cell differentiation
GO:0007266	0.641	Rho protein signal transduction
GO:0022607	0.624	cellular component assembly
GO:0034330	0.614	cell junction organization
GO:0044319	0.608	wound healing, spreading of cells
GO:0072359	0.539	circulatory system development
GO:0048519	0.519	negative regulation of biological process
GO:0048513	0.506	animal organ development
GO:0048523	0.450	negative regulation of cellular process
GO:0019222	0.443	regulation of metabolic process
GO:0031323	0.386	regulation of cellular metabolic process
GO:0007049	0.382	cell cycle
GO:0060255	0.375	regulation of macromolecule metabolic process
GO:0080090	0.362	regulation of primary metabolic process
GO:0051171	0.352	regulation of nitrogen compound metabolic process
GO:1902531	0.340	regulation of intracellular signal transduction
GO:0051301	0.332	cell division
GO:0009893	0.322	positive regulation of metabolic process
GO:0065009	0.321	regulation of molecular function
GO:0008152	0.312	metabolic process
GO:0043254	0.309	regulation of protein-containing complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.997	membrane
GO:0005737	0.997	cytoplasm
GO:0071944	0.996	cell periphery
GO:0043226	0.992	organelle
GO:0005886	0.991	plasma membrane
GO:0005829	0.979	cytosol
GO:0043229	0.925	intracellular organelle
GO:0043227	0.924	membrane-bounded organelle
GO:0012505	0.879	endomembrane system
GO:0043231	0.822	intracellular membrane-bounded organelle
GO:0042995	0.821	cell projection
GO:0098590	0.689	plasma membrane region
GO:0005634	0.619	nucleus
GO:0120025	0.469	plasma membrane bounded cell projection
GO:0005576	0.459	extracellular region
GO:0030054	0.439	cell junction
GO:0070062	0.427	extracellular exosome
GO:0032153	0.391	cell division site
GO:0032991	0.329	protein-containing complex
GO:0032154	0.318	cleavage furrow
GO:0097708	0.300	intracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	1.000	GTP + H2O = GDP + H(+) + phosphate

[back to server]