StarFunc result for job id P61604

User Input

>input (102 residues)
MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEI
QPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P26772	0.929	0.929	4.853E-17	102	0.990	0.990	P26772.pdb.gz	CH10_RAT 10 kDa heat shock protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hspe1 PE=1 SV=3
2	PDB:4pj1Z	0.893	0.846	1.426E-14	108	0.980	0.926	4pj1Z.pdb.gz	Crystal structure of the human mitochondrial chaperonin symmetrical football complex.
3	AFDB:Q9VU35	0.913	0.904	4.617E-12	103	0.559	0.553	Q9VU35.pdb.gz	Q9VU35_DROME RH34413p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG11267 PE=1 SV=1
4	AFDB:Q8I5Q3	0.924	0.916	9.586E-12	103	0.412	0.408	Q8I5Q3.pdb.gz	Q8I5Q3_PLAF7 10 kDa chaperonin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1215300 PE=3 SV=2
5	AFDB:P34893	0.782	0.813	6.123E-11	98	0.480	0.500	P34893.pdb.gz	CH10_ARATH 10 kDa chaperonin, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CPN10 PE=1 SV=1
6	AFDB:O59804	0.867	0.851	1.345E-10	104	0.422	0.413	O59804.pdb.gz	CH10_SCHPO 10 kDa heat shock protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hsp10 PE=1 SV=1
7	AFDB:P38910	0.867	0.836	2.792E-10	106	0.431	0.415	P38910.pdb.gz	CH10_YEAST 10 kDa heat shock protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSP10 PE=1 SV=1
8	AFDB:P61493	0.909	0.917	3.495E-10	101	0.373	0.376	P61493.pdb.gz	CH10_THET8 Co-chaperonin GroES OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=groES PE=1 SV=2
9	AFDB:Q8LDC9	0.773	0.811	7.676E-10	97	0.431	0.454	Q8LDC9.pdb.gz	Q8LDC9_ARATH GroES-like family protein OS=Arabidopsis thaliana OX=3702 GN=At1g23100 PE=1 SV=1
10	AFDB:P9WPE5	0.906	0.923	9.610E-10	100	0.333	0.340	P9WPE5.pdb.gz	CH10_MYCTU Co-chaperonin GroES OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=groES PE=1 SV=1
11	AFDB:P0A6F9	0.832	0.872	3.500E-9	97	0.333	0.351	P0A6F9.pdb.gz	CH10_ECOLI Co-chaperonin GroES OS=Escherichia coli (strain K12) OX=83333 GN=groES PE=1 SV=1
12	PDB:1aonO	0.789	0.826	1.027E-7	97	0.333	0.351	1aonO.pdb.gz	The crystal structure of the asymmetric GroEL-GroES-(ADP)7 chaperonin complex.
13	PDB:1p3hA	0.687	0.706	1.610E-7	99	0.314	0.323	1p3hA.pdb.gz
14	PDB:1wnrG	0.740	0.868	2.016E-7	86	0.333	0.395	1wnrG.pdb.gz
15	PDB:1wnrA	0.678	0.910	2.135E-6	75	0.275	0.373	1wnrA.pdb.gz
16	PDB:1hx5A	0.633	0.776	6.568E-6	82	0.294	0.366	1hx5A.pdb.gz
17	PDB:1g31A	0.591	0.566	4.206E-3	107	0.196	0.187	1g31A.pdb.gz
18	PDB:2cgtO	0.528	0.636	6.602E-2	83	0.157	0.193	2cgtO.pdb.gz
19	PDB:1yb5A	0.451	0.160	3.010E-1	324	0.176	0.056	1yb5A.pdb.gz	Crystal Structure of human Zeta-Crystallin at 1.85A
20	PDB:1wlyA	0.420	0.146	5.585E-1	322	0.167	0.053	1wlyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61604	1.94e-67	199	102	1.000	1.000	CH10_HUMAN 10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2
2	P26772	1.62e-66	197	102	0.990	0.990	CH10_RAT 10 kDa heat shock protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hspe1 PE=1 SV=3
3	Q64433	1.28e-64	192	102	0.961	0.961	CH10_MOUSE 10 kDa heat shock protein, mitochondrial OS=Mus musculus OX=10090 GN=Hspe1 PE=1 SV=2
4	Q9JI95	7.68e-57	172	102	0.941	0.941	Q9JI95_MOUSE CPN10-like protein OS=Mus musculus OX=10090 GN=Hspe1-rs1 PE=3 SV=1
5	Q9VU35	7.73e-31	107	103	0.539	0.534	Q9VU35_DROME RH34413p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG11267 PE=1 SV=1
6	P34893	3.29e-27	97.4	98	0.480	0.500	CH10_ARATH 10 kDa chaperonin, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CPN10 PE=1 SV=1
7	Q8LDC9	1.65e-23	88.2	97	0.422	0.443	Q8LDC9_ARATH GroES-like family protein OS=Arabidopsis thaliana OX=3702 GN=At1g23100 PE=1 SV=1
8	O59804	1.87e-22	85.5	104	0.402	0.394	CH10_SCHPO 10 kDa heat shock protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hsp10 PE=1 SV=1
9	P38910	4.83e-21	82.0	106	0.441	0.425	CH10_YEAST 10 kDa heat shock protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSP10 PE=1 SV=1
10	Q57WR6	1.02e-18	75.9	100	0.402	0.410	Q57WR6_TRYB2 10 kDa heat shock protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.610 PE=3 SV=1
11	Q8I5Q3	1.04e-18	76.3	103	0.382	0.379	Q8I5Q3_PLAF7 10 kDa chaperonin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1215300 PE=3 SV=2
12	P61493	1.81e-16	70.5	101	0.373	0.376	CH10_THET8 Co-chaperonin GroES OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=groES PE=1 SV=2
13	P9WPE5	5.27e-14	63.9	100	0.324	0.330	CH10_MYCTU Co-chaperonin GroES OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=groES PE=1 SV=1
14	P0A6F9	2.49e-13	62.4	97	0.333	0.351	CH10_ECOLI Co-chaperonin GroES OS=Escherichia coli (strain K12) OX=83333 GN=groES PE=1 SV=1
15	P0A6G1	2.49e-13	62.4	97	0.333	0.351	CH10_ECO57 Co-chaperonin GroES OS=Escherichia coli O157:H7 OX=83334 GN=groES PE=3 SV=1
16	O51683	3.46e-13	61.6	90	0.304	0.344	CH10_BORBU Co-chaperonin GroES OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=groES PE=3 SV=2
17	O65282	1.70e-10	57.8	253	0.333	0.134	CH20_ARATH 20 kDa chaperonin, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CPN20 PE=1 SV=2
18	P0A0R3	3.45e-10	54.7	118	0.353	0.305	CH10_HELPY Co-chaperonin GroES OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=groES PE=1 SV=1
19	Q97NV3	1.32e-07	47.4	94	0.314	0.340	CH10_STRPN Co-chaperonin GroES OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=groES PE=1 SV=1
20	Q8IDZ8	4.18e-07	48.1	258	0.275	0.109	Q8IDZ8_PLAF7 20 kDa chaperonin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1333000 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00166 Cpn10	8.6e-26	101.1	Chaperonin 10 Kd subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 79684.XP_005366473.1

Rank	PPI partner	STRING score	Description
1	79684.XP_005360837.1	0.997	Striatin isoform X1
2	79684.XP_005348751.1	0.994	Sarcolemmal membrane-associated protein isoform X1
3	79684.XP_005369835.1	0.994	CTTNBP2 N-terminal-like protein
4	79684.XP_005364659.1	0.993	FGFR1 oncogene partner 2 homolog isoform X1
5	79684.XP_005344168.1	0.992	Programmed cell death protein 10
6	79684.XP_005367903.1	0.992	Striatin-interacting protein 1 isoform X1
7	79684.XP_005365821.1	0.991	Striatin-interacting proteins 2-like isoform X1
8	79684.XP_005356732.1	0.988	T-complex protein 1 subunit epsilon
9	79684.XP_005371959.1	0.988	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform-like
10	79684.XP_005361100.1	0.987	Striatin-4
11	79684.XP_005366474.1	0.986	60 kDa heat shock protein, mitochondrial
12	79684.XP_005372406.1	0.986	60 kDa heat shock protein, mitochondrial-like
13	79684.XP_005357180.1	0.985	Suppressor of IKBKE 1 isoform X1
14	79684.XP_005363445.1	0.984	T-complex protein 1 subunit alpha
15	79684.XP_005366528.1	0.984	T-complex protein 1 subunit delta
16	79684.XP_005345367.1	0.982	T-complex protein 1 subunit theta
17	79684.XP_005344599.1	0.979	T-complex protein 1 subunit zeta isoform X1
18	79684.XP_005348359.1	0.979	T-complex protein 1 subunit gamma-like
19	79684.XP_005349441.1	0.979	T-complex protein 1 subunit zeta-2 isoform X1
20	79684.XP_005356940.1	0.979	T-complex protein 1 subunit gamma isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.997	RNA binding
GO:0051087	0.910	chaperone binding
GO:0005102	0.629	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0006457	0.931	protein folding
GO:0050896	0.909	response to stimulus
GO:0006950	0.670	response to stress
GO:0065007	0.489	biological regulation
GO:0042221	0.487	response to chemical
GO:0032501	0.454	multicellular organismal process
GO:0050789	0.411	regulation of biological process
GO:0010033	0.349	response to organic substance
GO:0006986	0.337	response to unfolded protein
GO:0032502	0.327	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0043233	0.856	organelle lumen
GO:0016020	0.855	membrane
GO:0070013	0.852	intracellular organelle lumen
GO:0070062	0.431	extracellular exosome
GO:0005759	0.422	mitochondrial matrix
GO:0032991	0.362	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]