StarFunc result for job id P61619

User Input

>input (476 residues)
MAIKFLEVIKPFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSAD
PFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFG
MIITIGQSIVYVMTGMYGDPSEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGIS
LFIATNICETIVWKAFSPTTVNTGRGMEFEGAIIALFHLLATRTDKVRALREAFYRQNLP
NLMNLIATIFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSN
LYVISQMLSARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLEDPVH
AVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTA
AAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEVGSMGALLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P38377	0.994	0.994	2.557E-67	476	0.998	0.998	P38377.pdb.gz	S61A1_CANLF Protein transport protein Sec61 subunit alpha isoform 1 OS=Canis lupus familiaris OX=9615 GN=SEC61A1 PE=1 SV=3
2	AFDB:Q8STG9	0.989	0.989	3.382E-65	476	0.893	0.893	Q8STG9.pdb.gz	Q8STG9_DROME DSec61alpha OS=Drosophila melanogaster OX=7227 GN=Sec61alpha PE=1 SV=1
3	AFDB:O80774	0.972	0.974	6.919E-57	475	0.676	0.678	O80774.pdb.gz	O80774_ARATH AT2G34250 protein OS=Arabidopsis thaliana OX=3702 GN=At2g34250 PE=2 SV=1
4	AFDB:Q9ZV90	0.970	0.972	1.296E-56	475	0.672	0.674	Q9ZV90.pdb.gz	Q9ZV90_ARATH F9K20.24 protein OS=Arabidopsis thaliana OX=3702 GN=At1g78720 PE=1 SV=1
5	AFDB:Q9P8E3	0.957	0.951	2.667E-51	479	0.576	0.572	Q9P8E3.pdb.gz	SC61A_CANAL Protein transport protein SEC61 subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SEC61 PE=3 SV=2
6	AFDB:Q385E6	0.969	0.959	1.052E-49	481	0.544	0.538	Q385E6.pdb.gz	Q385E6_TRYB2 Pretranslocation protein, alpha subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4100 PE=3 SV=1
7	AFDB:P32915	0.950	0.943	1.884E-49	480	0.548	0.544	P32915.pdb.gz	SC61A_YEAST Protein transport protein SEC61 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC61 PE=1 SV=1
8	AFDB:P79088	0.955	0.950	1.992E-47	479	0.563	0.559	P79088.pdb.gz	SC61A_SCHPO Protein transport protein sec61 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec61 PE=2 SV=1
9	PDB:6ftgx	0.816	0.906	1.710E-41	426	0.889	0.993	6ftgx.pdb.gz	Structural basis for coupling protein transport and N-glycosylation at the mammalian endoplasmic reticulum.
10	PDB:2wwbA	0.740	0.740	3.444E-40	476	0.998	0.998	2wwbA.pdb.gz	Structure of Monomeric Yeast and Mammalian Sec61 Complexes Interacting with the Translating Ribosome.
11	PDB:7kahA	0.856	0.921	2.433E-38	441	0.534	0.576	7kahA.pdb.gz
12	AFDB:O42965	0.880	0.882	9.329E-35	475	0.311	0.312	O42965.pdb.gz	YGMH_SCHPO Uncharacterized protein C19G7.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC19G7.17 PE=4 SV=2
13	PDB:6z3tA	0.724	0.889	1.269E-34	382	0.796	0.992	6z3tA.pdb.gz	Structure of the Inhibited State of the Sec Translocon.
14	AFDB:A0A1D8PDL0	0.839	0.804	4.527E-32	499	0.315	0.301	A0A1D8PDL0.pdb.gz	A0A1D8PDL0_CANAL Ssh1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSH1 PE=3 SV=1
15	PDB:6n3qA	0.758	0.917	5.536E-31	391	0.487	0.593	6n3qA.pdb.gz
16	PDB:6nd1B	0.775	0.940	7.576E-31	390	0.492	0.600	6nd1B.pdb.gz
17	PDB:3mp7A	0.702	0.853	4.200E-20	387	0.294	0.362	3mp7A.pdb.gz
18	PDB:2ww9A	0.693	0.676	7.147E-17	490	0.309	0.300	2ww9A.pdb.gz	Structure of Monomeric Yeast and Mammalian Sec61 Complexes Interacting with the Translating Ribosome.
19	PDB:4u4tA	0.143	0.149	9.072E-2	444	0.130	0.140	4u4tA.pdb.gz	Structural basis for dynamic mechanism of nitrate/nitrite antiport by NarK
20	PDB:4av6A	0.137	0.118	1.135E-1	655	0.124	0.090	4av6A.pdb.gz	The Structure and Catalytic Cycle of a Sodium-Pumping Pyrophosphatase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O80774	0.0	674	475	0.676	0.678	O80774_ARATH AT2G34250 protein OS=Arabidopsis thaliana OX=3702 GN=At2g34250 PE=2 SV=1
2	P32915	0.0	548	480	0.553	0.548	SC61A_YEAST Protein transport protein SEC61 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC61 PE=1 SV=1
3	P38377	0.0	966	476	0.998	0.998	S61A1_CANLF Protein transport protein Sec61 subunit alpha isoform 1 OS=Canis lupus familiaris OX=9615 GN=SEC61A1 PE=1 SV=3
4	P61619	0.0	967	476	1.000	1.000	S61A1_HUMAN Protein transport protein Sec61 subunit alpha isoform 1 OS=Homo sapiens OX=9606 GN=SEC61A1 PE=1 SV=2
5	P61620	0.0	967	476	1.000	1.000	S61A1_MOUSE Protein transport protein Sec61 subunit alpha isoform 1 OS=Mus musculus OX=10090 GN=Sec61a1 PE=1 SV=2
6	P61621	0.0	967	476	1.000	1.000	S61A1_RAT Protein transport protein Sec61 subunit alpha isoform 1 OS=Rattus norvegicus OX=10116 GN=Sec61a1 PE=2 SV=2
7	Q385E6	0.0	538	481	0.542	0.536	Q385E6_TRYB2 Pretranslocation protein, alpha subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4100 PE=3 SV=1
8	Q8RWJ5	0.0	674	475	0.679	0.680	Q8RWJ5_ARATH SecY protein transport family protein OS=Arabidopsis thaliana OX=3702 GN=SEC PE=2 SV=1
9	Q8STG9	0.0	870	476	0.893	0.893	Q8STG9_DROME DSec61alpha OS=Drosophila melanogaster OX=7227 GN=Sec61alpha PE=1 SV=1
10	Q8TC24	0.0	787	418	0.811	0.923	Q8TC24_HUMAN SEC61 translocon subunit alpha 2 OS=Homo sapiens OX=9606 GN=SEC61A2 PE=1 SV=1
11	Q90YL4	0.0	921	476	0.958	0.958	S61A2_DANRE Protein transport protein Sec61 subunit alpha-like 2 OS=Danio rerio OX=7955 GN=sec61al2 PE=2 SV=3
12	Q90ZM2	0.0	949	476	0.971	0.971	S61A1_DANRE Protein transport protein Sec61 subunit alpha-like 1 OS=Danio rerio OX=7955 GN=sec61al1 PE=2 SV=3
13	Q9JLR1	0.0	901	476	0.935	0.935	S61A2_MOUSE Protein transport protein Sec61 subunit alpha isoform 2 OS=Mus musculus OX=10090 GN=Sec61a2 PE=2 SV=3
14	Q9P8E3	0.0	586	479	0.576	0.572	SC61A_CANAL Protein transport protein SEC61 subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SEC61 PE=3 SV=2
15	Q9ZV90	0.0	676	475	0.672	0.674	Q9ZV90_ARATH F9K20.24 protein OS=Arabidopsis thaliana OX=3702 GN=At1g78720 PE=1 SV=1
16	P79088	1.36e-180	516	479	0.563	0.559	SC61A_SCHPO Protein transport protein sec61 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec61 PE=2 SV=1
17	Q8U019	2.19e-89	282	468	0.340	0.346	SECY_PYRFU Protein translocase subunit SecY OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=secY PE=1 SV=1
18	O42965	1.94e-83	267	475	0.313	0.314	YGMH_SCHPO Uncharacterized protein C19G7.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC19G7.17 PE=4 SV=2
19	A0A1D8PDL0	8.89e-72	237	499	0.328	0.313	A0A1D8PDL0_CANAL Ssh1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSH1 PE=3 SV=1
20	P38353	3.84e-70	233	490	0.307	0.298	SSH1_YEAST Sec sixty-one protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSH1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11188 DUF2975	1.4e+02	13.7	Protein of unknown function (DUF2975)
2	PF20312 DUF6608	3.8e+02	12.4	Family of unknown function (DUF6608)
3	PF10559 Plug_translocon	1.3e-14	65.0	Plug domain of Sec61p
4	PF00344 SecY	8.9e-73	256.9	SecY
5	PF14036 YlaH	1.5e+02	14.1	YlaH-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008826780.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008850115.1	0.999	Sec61 translocon beta subunit
2	1026970.XP_008849861.1	0.997	Sec61 translocon gamma subunit
3	1026970.XP_008848534.1	0.990	Translocation protein SEC63 homolog
4	1026970.XP_008828341.1	0.959	SEC62 homolog, preprotein translocation factor
5	1026970.XP_008831459.1	0.948	60S ribosomal protein L9
6	1026970.XP_008825153.1	0.940	40S ribosomal protein S15a
7	1026970.XP_008835382.1	0.930	40S ribosomal protein S15
8	1026970.XP_008852058.1	0.916	Signal sequence receptor subunit 2
9	1026970.XP_008836816.1	0.914	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit
10	1026970.XP_008826880.1	0.912	60S ribosomal protein L17
11	1026970.XP_008843289.1	0.912	40S ribosomal protein S11
12	1026970.XP_008823042.1	0.909	Heat shock protein family A (Hsp70) member 5
13	1026970.XP_008826905.1	0.903	60S ribosomal protein L23a
14	1026970.XP_008838402.1	0.891	40S ribosomal protein S18
15	1026970.XP_008824182.1	0.890	Hypoxia up-regulated protein 1
16	1026970.XP_008820997.1	0.888	Ribosomal protein S5
17	1026970.XP_008825977.1	0.887	Ribosomal protein S9
18	1026970.XP_008842464.1	0.887	40S ribosomal protein S3
19	1026970.XP_008842128.1	0.885	Surfeit locus protein 4
20	1026970.XP_008832600.1	0.883	Ribosomal protein L8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0022857	0.885	transmembrane transporter activity
GO:0097159	0.763	organic cyclic compound binding
GO:1901363	0.760	heterocyclic compound binding
GO:0003676	0.736	nucleic acid binding
GO:0003723	0.702	RNA binding
GO:0043021	0.471	ribonucleoprotein complex binding
GO:0043022	0.464	ribosome binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0072001	0.987	renal system development
GO:0048793	0.955	pronephros development
GO:0009987	0.953	cellular process
GO:0072006	0.773	nephron development
GO:0051179	0.765	localization
GO:0039019	0.709	pronephric nephron development
GO:0051234	0.704	establishment of localization
GO:0050896	0.701	response to stimulus
GO:0033036	0.692	macromolecule localization
GO:0070972	0.680	protein localization to endoplasmic reticulum
GO:0006810	0.631	transport
GO:0045184	0.520	establishment of protein localization
GO:0065007	0.481	biological regulation
GO:0042221	0.469	response to chemical
GO:0050789	0.462	regulation of biological process
GO:0010033	0.414	response to organic substance
GO:0008152	0.404	metabolic process
GO:0071702	0.404	organic substance transport
GO:0006950	0.399	response to stress
GO:0050794	0.380	regulation of cellular process
GO:0051649	0.350	establishment of localization in cell
GO:0071704	0.319	organic substance metabolic process
GO:0015031	0.316	protein transport
GO:0044419	0.315	biological process involved in interspecies interaction between organisms

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0016020	0.979	membrane
GO:0031090	0.882	organelle membrane
GO:0098827	0.702	endoplasmic reticulum subcompartment
GO:0042175	0.699	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.694	endoplasmic reticulum membrane
GO:0005829	0.568	cytosol
GO:0032991	0.365	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]